Identifiers and Description

Gene Model Identifier

TTHERM_00066910

Standard Name

None

Aliases

PreTt13181 | 4.m00580 | 3707.m00218

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00066910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02092.19.997093137033517e-262protein kinase domain-containi
ng protein (665 aa)
OxytrichaContig12431.0.g479.997093137033517e-262Protein kinase domain
SGDYDL159W7.003160085026828e-16STE7 Signal transducing MAP ki
nase kinase involved in pherom
one response, where it phospho
rylates Fus3p, and in the pseu
dohyphal/invasive growth pathw
ay, through phosphorylation of
Kss1p; phosphorylated by Ste1
1p, degraded by ubiquitin path
way
Stentor CoeruleusSteCoe_198570.000000000000004658886145103398
WormBaseWBGene000121620.000000000000005001692698841201locus:sek-6 status:Partially
_confirmed UniProt:O01706
protein_id:CAB08354.1
DictyBaseDDB_G02679620.000000000000005001692698841201tsuA on chromosome: 1 position
1191800 to 1198906

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00066910(coding)
ATGTTTAGGAAATAAGATTTTAAAAAACTAGATCTTTTAGGATCTGGCAAAAAGCATACA
AAGATATTCAAAGTATAGCATTTGTAAACAGGTAAAATATATGCTTTGAAGGAGATAGAA
GCGAAAACTTTAGACAAGTTGAATGAATATAAAGAAGAAGCAGTCTAACTATCAAAAGTG
TAGAATTGCAATAATGTTATCAAATTTCATGGATACTACTTTTCGGAAACTTAGTATTAA
ACATTTCGTTTGGGAATTATTACAGAATTTATGGATCACAATACTAATTTAGAAATGATA
TATAGAAAGCGTAAGAAATTAGGAATATAATGGAAGGAATCTGAACTTGTTACCATTATG
TTCTCTCTTATATCTGTGTGCTCACTCCTTTAGCAAAAAGGAATTTGCCACAGAGATATT
AAGCCTGCTAATATATTTATAATGGAAAATGGAGAAGTCAAATTAATTGACTTTGGCGAG
AGCAAAGATTATTTTTATGATCCAGAAGATGAGTCAAAAAATACTTACACCATGGCTACA
ATCAGAGGAACTCCTCAATATCTGTCTCCTATTTTATGGAAGGCTCATGTAGTAGATGGA
AATTCTCGCTACGTTGAACATAATATCTATAAGTCAGATGTTTTTTCTAGCGGATTGTTG
ATTTACTAACTTGCCGCTATCGAAGAAGTAACTGGATTTAATAATAAGACACCTCAAACA
GATGGTGAATAACTGATTAAATAAGCTCTCATTGAATTAGAAAAGAAGTACTCTAATTAA
TTTGTAAATATCATTGCTCTTATGTTAATCTTTGAAGAGAGTGGTCGTCCAAGCTTTGTC
GAAATTGAGTAGTTATTCATTGAGCATGAAAACTAAGCTCGCGAAACAGCTAATTTAAAA
GAACCAAAAAAGCGTAAACTAAATGAATATATTCGCATGTATAACTAATAATTTAATACG
CTTCTAAAAGCTTAGCCAATTGGTAGTTAATCAGTATCTAAATCTACTTAACTGATATCA
TAGTAGCAAAGTAATAATTTATCAAAACAAAGCAATAAAGAAAATTAAAATATCAATGGA
GATTCCAATACAAATGGAAATCCTACGAGCACAAAATCTGCAATTAACAAAGAAAATTAT
GGATAATTTTATAAAGAATCAACTTTAATATTAAACGAAAACTGCTACTGGTTTGAATTC
GGAGGATCATCAATAGGAAAATTCTCCATTCACAAATAAAAGTGGAAAATTGCTTAAAAT
CCAGACAAAACCAATTTCCCCTATCATTTTTCTACAATTTATATTCCTGAATAAAAAGGC
TACTTTTTGCTAGGAGGATAAAGTAATATCAATTTTAGAACTTTTGTCAACGGAAAAATG
GCTATTTCCAAAAATCCTATGCCAGTCATAAAGAACTTCTTTCCTGCAGTATATTACAGT
CATCGTGTATACACTTTCGGAGGATACGATTCAAATTTAAAAGTGTAGCTTTCATCATGT
GAATGCTATAATATATAAGCAGAAAAATGGTAATCGATAGGAGATTTAATTATTCCTAGA
AGCTAATCCGCAGGATGCAGGATTAATGACAACGAAATATTAATATTTGGTGGTTACAAT
AAAGAAAAGGGAACTCTAGATTCTATAGAAAGATATCTAATTAATGAAAATAAATTTGAG
GTTACCAACATCAAGCTTCCAATACCCTTAAGAAGATTTATGGTAGTTCGTGTTTCAAAT
AATAATGCCCTCATATTGGGAGGACTAACTAAATTTTCAAAGGAATCATAAAAAGTCTTT
AAACTTGAATATGATAAGAAAGAAATTATAGAGCTAGAATCCTTAGAAAAAGGAGGAGTT
ATAGAAAATGAAATACTTGTAGATAATGAAGATTATATGCACATATTTTTAGAACATGCG
AACGGAACTTCTCCTCATTCTCATATAAAATACTACTACGATCCAAAAGCTACAAGATAT
GTTACAAAACAAGAATGA


>TTHERM_00066910(protein)
MFRKQDFKKLDLLGSGKKHTKIFKVQHLQTGKIYALKEIEAKTLDKLNEYKEEAVQLSKV
QNCNNVIKFHGYYFSETQYQTFRLGIITEFMDHNTNLEMIYRKRKKLGIQWKESELVTIM
FSLISVCSLLQQKGICHRDIKPANIFIMENGEVKLIDFGESKDYFYDPEDESKNTYTMAT
IRGTPQYLSPILWKAHVVDGNSRYVEHNIYKSDVFSSGLLIYQLAAIEEVTGFNNKTPQT
DGEQLIKQALIELEKKYSNQFVNIIALMLIFEESGRPSFVEIEQLFIEHENQARETANLK
EPKKRKLNEYIRMYNQQFNTLLKAQPIGSQSVSKSTQLISQQQSNNLSKQSNKENQNING
DSNTNGNPTSTKSAINKENYGQFYKESTLILNENCYWFEFGGSSIGKFSIHKQKWKIAQN
PDKTNFPYHFSTIYIPEQKGYFLLGGQSNINFRTFVNGKMAISKNPMPVIKNFFPAVYYS
HRVYTFGGYDSNLKVQLSSCECYNIQAEKWQSIGDLIIPRSQSAGCRINDNEILIFGGYN
KEKGTLDSIERYLINENKFEVTNIKLPIPLRRFMVVRVSNNNALILGGLTKFSKESQKVF
KLEYDKKEIIELESLEKGGVIENEILVDNEDYMHIFLEHANGTSPHSHIKYYYDPKATRY
VTKQE


>TTHERM_00066910(gene)
ATGTTTAGGAAATAAGATTTTAAAAAACTAGATCTTTTAGGATCTGGCAAAAAGCATACA
AAGATATTCAAAGTATAGCATTTGTAAACAGGTAAAATATATGCTTTGAAGGAGATAGAA
GCGAAAACTTTAGACAAGTTGAATGAATATAAAGAAGAAGCAGTCTAACTATCAAAAGTG
TAGAATTGCAATAATGTTATCAAATTTCATGGATACTACTTTTCGGAAACTTAGTATTAA
ACATTTCGTTTGGGAATTATTACAGAATTTATGGATCACAATACTAATTTAGAAATGATA
TATAGAAAGCGTAAGAAATTAGGAATATAATGGAAGGAATCTGAACTTGTTACCATTATG
TTCTCTCTTATATCTGTGTGCTCACTCCTTTAGCAAAAAGGTAAACTTTCTAAGATGTTA
AATAGATAGCCATTTCTTTAACTTTCTCAATATATAATATAGGAATTTGCCACAGAGATA
TTAAGCCTGCTAATATATTTATAATGGAAAATGGAGAAGTCAAATTAATTGACTTTGGCG
AGAGCAAAGATTATTTTTATGATCCAGAAGATGAGTCAAAAAATACTTACACCGTAAGTT
TTTTATCATTTAAAATATTTTTCTAAGATTTCAAAAAAAACTTCTAGCATGATCTTCTAT
CATAACAATTATAATCAATCAAGTGATTGATTGATAAATTTATAGATTTTTAATAATCCG
TTAATAATCAAAATGCACAAAAGTTATTGCTATTTTAGCACAAATTAAAAAATATGAAGT
CAAAAATATTAATTTGTTAAGCTAAAAGCAAACATATTTTAGATGCATGCTTATTTAAAA
ACATCCATATAATTTAAATTAAAATAATTTTAACAGATGGCTACAATCAGAGGAACTCCT
CAATATCTGTCTCCTATTTTATGGAAGGCTCATGTAGTAGATGGAAATTCTCGCTACGTT
GAACATAATATCTATAAGTCAGATGTTTTTTCTAGCGGATTGTTGATTTACTAACTTGCC
GCTATCGAAGAAGTAACTGGATTTAATAATAAGACACCTCAAACAGATGGTGAATAACTG
ATTAAATAAGCTCTCATTGAATTAGAAAAGAAGTACTCTAATTAATTTGTAAATATCATT
GCTCTTATGTTAATCTTTGAAGAGAGTGGTCGTCCAAGCTTTGTCGAAATTGAGTAGTTA
TTCATTGAGCATGAAAACTAAGCTCGCGAAACAGCTAATTTAAAAGAACCAAAAAAGCGT
AAACTAAATGAATATATTCGCATGTATAACTAATAATTTAATACGCTTCTAAAAGCTTAG
CCAATTGGTAGTTAATCAGTATCTAAATCTACTTAACTGATATCATAGTAGCAAAGTAAT
AATTTATCAAAACAAAGCAATAAAGAAAATTAAAATATCAATGGAGATTCCAATACAAAT
GGAAATCCTACGAGCACAAAATCTGCAATTAACAAAGAAAATTATGGATAATTTTATAAA
GAATCAACTTTAATATTAAACGAAAACTGCTACTGGTTTGAATTCGGAGGATCATCAATA
GGAAAATTCTCCATTCACAAATAAAAGTGGAAAATTGCTTAAAATCCAGACAAAACCAAT
TTCCCCTATCATTTTTCTACAATTTATATTCCTGAATAAAAAGGCTACTTTTTGCTAGGA
GGATAAAGTAATATCAATTTTAGAACTTTTGTCAACGGAAAAATGGCTATTTCCAAAAAT
CCTATGCCAGTCATAAAGAACTTCTTTCCTGCAGTATATTACAGTCATCGTGTATACACT
TTCGGAGGATACGATTCAAATTTAAAAGTGTAGCTTTCATCATGTGAATGCTATAATATA
TAAGCAGAAAAATGGTAATCGATAGGAGATTTAATTATTCCTAGAAGCTAATCCGCAGGA
TGCAGGATTAATGACAACGAAATATTAATATTTGGTGGTTACAATAAAGAAAAGGGAACT
CTAGATTCTATAGAAAGATATCTAATTAATGAAAATAAATTTGAGGTTACCAACATCAAG
CTTCCAATACCCTTAAGAAGATTTATGGTAGTTCGTGTTTCAAATAATAATGCCCTCATA
TTGGGAGGACTAACTAAATTTTCAAAGGAATCATAAAAAGTCTTTAAACTTGAATATGAT
AAGAAAGAAATTATAGAGCTAGAATCCTTAGAAAAAGGAGGAGTTATAGAAAATGAAATA
CTTGTAGATAATGAAGATTATATGCACATATTTTTAGAACATGCGAACGGAACTTCTCCT
CATTCTCATATAAAATACTACTACGATCCAAAAGCTACAAGATATGTTACAAAACAAGAA
TGA