Identifiers and Description

Gene Model Identifier

TTHERM_00059350

Standard Name

None

Aliases

PreTt13119 | 4.m00518 | 3707.m00163

Description

Copper/zinc superoxide dismutase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00080 ) copper/zinc superoxide dismutase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02037.14.00102881285134e-124copper/zinc superoxide dismuta
se (196 aa)
OxytrichaContig14213.0.g442.00085363250024e-42Copper/zinc superoxide dismuta
se (SODC)
SGDYJR104C4.00043745848725e-40SOD1 Cytosolic copper-zinc sup
eroxide dismutase; some mutati
ons are analogous to those tha
t cause ALS (amyotrophic later
al sclerosis) in humans
DictyBaseDDB_G02674209.99648502569394e-38sodA on chromosome: 1 position
338107 to 338878
WormBaseWBGene000049302.00066225808554e-35locus:sod-1 Superoxide dismu
tase [Cu-Zn] status:Confirme
d UniProt:P34697 protein_i
d:CCD64617.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00059350(coding)
ATGTTAACCTTATTATCAAAATTTATACAAACAAAGAGTGATATTTATTTAGAACAAATT
TTTAATTTTCTAGTAACTAAATTTTATATCAAAATAAGTTAAAAAATTCTTTTAAAAATA
GCTAGATAGATACAAACAAACAAACAAACAAACTTAAGCAAAAAACATATTTTAAAAAGT
AGGATGTTAGTAAAGAGTGTTTTGTTAGGAGCTGCTGGTACAGCCTTATTTTCATATTCT
AATTAAAAGACATACAAAGCTGAAAAAAATGCAGGAGAAAGAATAGCTATTGCAATATTA
TACCCTGCTCCAGGATATGATGTTACTGGTGCTGTTACTTTCTACTAGAAAGATTTACAT
TCAAAAACTTAAATTACAGCTCGTCTTAAAAATTTAAATCCTAATGGACTATTTGGTTTT
CACATTCATGAGTTTGGTGACTTGACTAATGGAACAGAATCTGTTGGTCCTCACTATAAT
CCATTTAATAAAAAGCACGGAAGTCCTAGAGAAGATGAATCTCATATGGGTGATTTAGGC
AATATTAAAGCAGATGATCTTGGTTATGGTTATTATACTTCTGAAAATAATAAAGTTACT
TTATTTGGAGAATATTCTGTTGTTGGTAGAAGCGTATTAGTTAATAAGAATGAAGATGAT
TTAGGTAGAGGCAACCACCCAGACTCCCATACAAATGGTCACTCTGGTCCCAGAATAGCT
GCTGGTATTATTGGACTTGCTTATGAACTTAAAAACTTGCCTGCTAGATTTTGA


>TTHERM_00059350(protein)
MLTLLSKFIQTKSDIYLEQIFNFLVTKFYIKISQKILLKIARQIQTNKQTNLSKKHILKS
RMLVKSVLLGAAGTALFSYSNQKTYKAEKNAGERIAIAILYPAPGYDVTGAVTFYQKDLH
SKTQITARLKNLNPNGLFGFHIHEFGDLTNGTESVGPHYNPFNKKHGSPREDESHMGDLG
NIKADDLGYGYYTSENNKVTLFGEYSVVGRSVLVNKNEDDLGRGNHPDSHTNGHSGPRIA
AGIIGLAYELKNLPARF


>TTHERM_00059350(gene)
AGACAAAGAGATCTCATGTTAACCTTATTATCAAAATTTATACAAACAAAGAGTGATATT
TATTTAGAACAAATTTTTAATTTTCTAGTAACTAAATTTTATATCAAAATAAGTTAAAAA
ATTCTTTTAAAAATAGCTAGATAGATACAAACAAACAAACAAACAAACTTAAGCAAAAAA
CATATTTTAAAAAGTAGGATGTTAGTAAAGAGTGTTTTGTTAGGAGCTGCTGGTACAGCC
TTATTTTCATATTCTAATTAAAAGACATACAAAGCTGAAAAAAATGCAGGAGAAAGAATA
GCTATTGCAATATTATACCCTGCTCCAGGATATGATGTTACTGGTGCTGTTACTTTCTAC
TAGAAAGATTTACATTCAAAAACTTAAATTACAGCTCGTCTTAAAAATTTAAATCCTAAT
GGACTATTTGGTTTTCACATTCATGAGTTTGGTGACTTGACTAATGGAACAGAATCTGTT
GGTCCTCACTATAATCCATTTAATAAAAAGCACGGAAGTCCTAGAGAAGATGAATCTCAT
ATGGGTGATTTAGGTACAAATAATTTTTATACCAAAAGATATAAAATATTTTATAATTCA
TAGTTTAGTTAAATGCCTTTCAGGATAAATATTTACACAAAAAAAGCAAAATACAATAAA
TTTTAAAGTAAATTTTAGCTACAAATAGTTTTACATAAATATAATAAACTTATAAAGAAT
AATTTATTAAGAAAATAAAATATTTCTTTAAATTTGTTCTAAAATTTTAAAATAATTATT
TAAATAGGCAATATTAAAGCAGATGATCTTGGTTATGGTTATTATACTTCTGAAAATAAT
AAAGTTACTTTATTTGGAGAATATTCTGTTGTTGGTAGAAGCGTATTAGTTAATAAGAAT
GAAGATGATTTAGGTAGAGGCAACCACCCAGACTCCCATACAAATGGTCACTCTGGTCCC
AGAATAGCTGCTGGTATTATTGGACTTGCTTATGAACTTAAAAACTTGCCTGCTAGATTT
TGAGGGAAAAATATGTTAACTAAATAAATGAATGAATTTACTCTATTTTCAATAAAAATA
TATTAACTTAATAATAATGAAGTTTTTTTGTACATTTGCTTAGATATATCAAATATGTGT
GTGAGTATTTATTTTTCTTATTCAATGCATATAAAAATGAATTAATTTATC