Identifiers and Description

Gene Model Identifier

TTHERM_00059280

Standard Name

None

Aliases

PreTt13112 | 4.m00511 | 3707.m00156

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00059280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02030.19.001411022034644e-122hypothetical protein (284 aa)
OxytrichaContig3652.0.g1091.999790113608142e-24Ring finger domain
DictyBaseDDB_G02800891.9994498063102785e-22DDB_G0280089 on chromosome: 3
position 2915769 to 2917228
Stentor CoeruleusSteCoe_123440.000000000000004658886145103398
WormBaseWBGene000191850.0000000020002373268528243status:Partially_confirmed U
niProt:O76671 protein_id:CCD
68273.1
SGDYLR247C0.000005998506718272351IRC20 Putative helicase; local
izes to the mitochondrion and
the nucleus; YLR247C is not an
essential gene; null mutant d
isplays increased levels of sp
ontaneous Rad52p foci

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00059280(coding)
ATGGACACTTTAGACAATCACAATAATAACTAGTTGCAATAAAACATTGATAACTAAATT
GCTAGAAAAATGTGGTGTCACACATGCAAATTTGAATTTTAAACTGCAAATTCAACATCA
TTCGAATGTGTTAAATGTAAGAATGATTTTTGTGAAGAAATAGAACCTCAAATTGAGTAA
ATAGACGATCCAAGATAGTTTGTTCCTTTTGGTGAAGAGTAGAATCAAACTAATAACTAA
TAACAATTCCAAAGAAATGTTTAGAATTCTTAATAAAACAACCTTCAAAATGTTTAGTAT
CCCTAATAAAATAATCGCATGGGAAGTGCATCAACTATTCGTACAAATATCAATCGCTAA
GGTCAAGGTCAAGGTTAACCTACACTATCTTATTCTATTTCAATTTAGTCTACTTAGCTT
GAAAATCCATTCTTCGGAATTAATAACCTCATTTCAAATTTATTCCCTGTAACATCTCAA
CGTACAGGCCTATTTGGAATGAATGACAACAACTTTGATAATATAATTGACTTCTTGATG
CGTAATGACCCAAATGTTTATGGTACTCCACCTGCTTCTGAAAATTCCATTTCTAATTTA
CCAACTGTTACTTTCTCAACAGAATAAGTAAAAGAAGAAACCCTATGTGAATGTAGTGTC
TGCAAGGAAGAATTTACAGAAGGAGAACAATTAGTTAAAATGCCATGCAATCATATGTAT
CATAGCAGCTGTTTAGTCACTTGGCTTAAGATGCACAACTCTTGTCCTACTTGCCGTTAC
GAACTACCAACTGATAATTAGGATTATGAACGCAGAAAATAATAAAGAAATAATTAAAAT
CAAAACCGCAGAAATTGA


>TTHERM_00059280(protein)
MDTLDNHNNNQLQQNIDNQIARKMWCHTCKFEFQTANSTSFECVKCKNDFCEEIEPQIEQ
IDDPRQFVPFGEEQNQTNNQQQFQRNVQNSQQNNLQNVQYPQQNNRMGSASTIRTNINRQ
GQGQGQPTLSYSISIQSTQLENPFFGINNLISNLFPVTSQRTGLFGMNDNNFDNIIDFLM
RNDPNVYGTPPASENSISNLPTVTFSTEQVKEETLCECSVCKEEFTEGEQLVKMPCNHMY
HSSCLVTWLKMHNSCPTCRYELPTDNQDYERRKQQRNNQNQNRRN


>TTHERM_00059280(gene)
ATGGACACTTTAGACAATCACAATAATAACTAGTTGCAATAAAACATTGATAACTAAATT
GCTAGAAAAATGTGGTGTCACACATGCAAATTTGAATTTTAAACTGCAAATTCAACATCA
TTCGAATGTGTTAAATGTAAGAATGATTTTTGTGAAGAAATAGAACCTCAAATTGAGTAA
ATAGACGATCCAAGATAGTTTGTTCCTTTTGGTGAAGAGTAGAATCAAACTAATAACTAA
TAACAATTCCAAAGAAATGTTTAGAATTCTTAATAAAACAACCTTCAAAATGTTTAGTAT
CCCTAATAAAATAATCGCATGGGAAGTGCATCAAGTAATTTATCAATTTATTTATTGAGA
ATAATTTCTACATTTATCTAGCATCATATTATTTTTCAGAAATATATCAATGCATAAACG
AAAATTAATAATGCCAAAATTTTACATTACTAGCTAAGATTAAATATTAATTAGACTAAA
CTATGCTTGGCAAAATAATTTGGATTCTATTAAAACAAAATCTAAAAATTGCGGCTATTT
GCTGCAAAAATTATTTTTACTCAGCAAGACAAAGATAGTTTTTATATGAAGTTTATAAAA
CACATTCTTGATTAATAAAATACATAATAGCACTTGAAGTTAACAAATTTCATTTGCAAG
ATTGAATTATTACTTGGCATTTAATTTAATAGAATTAAATTTTTTTCACCTGTTTTCTTA
ATTTAGTAGCATTAAAATTACTAAAGATTATGGAAATAGATAGATTGATATAAATACGCC
CAAACAATTTTAATGTTAGAATATATTGATTAAATTAAAATAGTTTTAAAAATAATTAAT
CTTTTTTTATATATATAAAGCTATTCGTACAAATATCAATCGCTAAGGTCAAGGTCAAGG
TTAACCTACACTATCTTATTCTATTTCAATTTAGTCTACTTAGCTTGAAAATCCATTCTT
CGGAATTAATAACCTCATTTCAAATTTATTCCCTGTAACATCTCAACGTACAGGCCTATT
TGGAATGAATGACAACAACTTTGATAATATAATTGACTTCTTGATGCGTAATGACCCAAA
TGTTTATGGTACTCCACCTGCTTCTGAAAATTCCATTTCTAATTTACCAACTGTTACTTT
CTCAACAGAATAAGTAAAAGAAGAAACCCTATGTGAATGTAGTGTCTGCAAGGAAGAATT
TACAGAAGGAGAACAATTAGTTAAAATGCCATGCAATCATATGTATCATAGCAGCTGTTT
AGTCACTTGGCTTAAGATGCACAACTCTTGTCCTACTTGCCGTTACGAACTACCAACTGA
TAATTAGGATTATGAACGCAGAAAATAATAAAGAAATAATTAAAATCAAAACCGCAGAAA
TTGA