Identifiers and Description

Gene Model Identifier

TTHERM_00052540

Standard Name

None

Aliases

PreTt11434 | 3.m01819 | 3824.m03189

Description

Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to the GCN2 subfamily of the protein kinase PEK family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00052540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01514.19.997093137033517e-262protein kinase domain-containi
ng protein (901 aa)
OxytrichaContig9429.0.g376.002971818577897e-50Protein kinase domain
SGDYDR283C9.99723014177113e-33GCN2 Protein kinase, phosphory
lates the alpha-subunit of tra
nslation initiation factor eIF
2 (Sui2p) in response to starv
ation; activated by uncharged
tRNAs and the Gcn1p-Gcn20p com
plex; contributes to DNA damag
e checkpoint control
DictyBaseDDB_G02768291.000137892321693e-31ifkB on chromosome: 2 position
7412574 to 7416650
WormBaseWBGene000039701.9999391735788327e-19locus:pek-1 Eukaryotic trans
lation initiation factor 2-alp
ha kinase status:Confirmed
UniProt:Q19192 protein_id:C
AA91470.1
Stentor CoeruleusSteCoe_143260.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052540(coding)
ATGTAGCTTAATAATGGTAGTATCGCATTTGATAATCAATAGCTGAATTCTTAAACTTAG
CGAGTAGAAGAAAATTAAGGAAGTTTATTATCAAATTTATTGAGTATAATTTTTAGCGAA
TAAAATTTAATTGCATTGGTAATATTTTTAATTGGCTACTTTGTTGGAAGAAGAAAGAGA
AATAAGCCTTTAAAAAATGATGAAGTTTAAATTTAAAATGAAGAATTATAAAATAAAATA
TTTAATAGCGACTCATCATAACAAGGAGTTACATCTACAAAATAAACATTTAATATTGAG
TAAAATAGATCAGATTTTACAGGTCTGAACTTTGATTAAAATTCTTTTTCATAAAGAGGC
GTTATAGAATCTAGAAAATATTCAAACTAGAGTGGAGGAAATTACAATGAAGATATTTCT
TCTGCAAATTCTGATATTTCTTTTTAGAATAATGAAAATTAAGTGAAAAATACACATAAA
AATAGCTATTTAGAAGATCATTTTGAAGACAATAATTTATCTTCTTAGGGAAAAAGTGCA
GTGAAAAATGAAAGTCAAGTTTCAAATGAAAATTCAAAATAGCTGATATAGTAAAGCTAG
CAAATAAAGTTTGGATCAGATAATTAAAGCAGTGAAAATTAATATAAACATTATTAAGGT
GAATTAGCATTAGTTCCTTTTAAATAAAATGGAAACTCAAATTACTACAATAACAATATC
CACAATATGTAAAATTAGTTAATGATTGATAATGGTAGTTGCAGTGATAACAAGAGCTCA
AGTCAAGCCTAGTAACCTTTACAAAGAAAGTTGCTTAATGATATAGGAAGTGCTTTGGTC
AAAAAAAAAGCTAGACATAATAAAATGTATGGTTTAAGTGAAGAAAGTGAGGAAGAATTA
CTTTTTGAGTAGTGTACCTTTAAGAATCCGCCATTGAGAAAGAAGGCAGATTTTAAAATT
GAATTCGAGTAAGATGATGCTAAGGGAGTATATAGAAAGATAGAAACACACTAAGTTATT
ACTGACTATGTATAAACTAAAGAAATTCATAAAGAAATAGAAGAGATTAAGTAGACTTTC
TCATCATAATTCTAAATTAAAGAGAATCAAAATGTAAACGGCTTTAAGATGTCTCTTGTG
AAATAAAATTTATAAGTTATTCCCATGTTGGAAAAAATGAAAAGCTAAAGTATTTCAGAA
ATAAATAACCTAAACGATAGCGCTTAGCGTGGACAATTTAATTCTTATGAGAAGGAACAG
CAACTTGCTTTATATATGAAATCACCTTTTGAAGTTGAAACAAGAATTTCACCCCTTTAT
GAACAAAGTCATATCAAACAATATTTAGATAATGGCAAATTCAACAAATTCTTTAGAGTA
ATAGATGAATTAGGAAGAGGAGGTTTCGGAAGAGTTTATAAGGTGCAAAGTATGGTTGAA
GAAAAAATCTATGCAATAAAAAAAATAGCTGTTCCCTATGATGGATTTTCAAATCCAAAA
GAGCATAAGTATTTCAGAGAAGTAAAGAGTATTATGAGTCTTAATCACATCAACATTGTT
AGATATCACACAAGCTGGTGGGAAAATTGTGATGACGAAATGGTAAATTAAGTCAACGAA
TTCTTATAGACAAATAATAATTTATACTCTGATGACAATAGTCCTTCTGTTTCTGAAGCT
TATTAAAAAAATAAAAGTGACTACAACAGATCTTATGCACTCTCAAAACAAACTAACCAG
ACTCAGTCTTATGTTTTAAGCTACAATAATGATAATCTTTCTTGTATAGAATGGGAATAG
TCAGAAAATGAAAATCAAAACCCTAATATTTCTAACAATGATGGGATAAAAAAGAAATTA
GATGACTCTCAAACAATAAATGAATATCGTGAATAAAATAAAAGTCATAAGACTTTTAAT
TTTACAAAAGAACCTTCTTAATTGCTAACCTTATACATACAACTTGAATATTGCTCAGGA
AAAACTTTAAGAAATTACCTTGATGAATAAACTCATGGATTAGACAGCAAAGAAGCCTTC
CAAATATTTTCTTAAATGTTAGAAGGTGTAAATTATCTTCATAAAAACTAAATTATTCAT
AGAGATCTTAAGTAAATAATTTATTTATTGCTTTACTTTTAATTTAAATAATAAAAAATA
TAAAATAGACCTTCTAATATTCTGTTTGAAAACAAAATTGCAAAAATTGCAGATTTCGGT
TTGTCGATTTAATAGGAATTAGGACTTATTAATGCTAACTAAGAATTACCATCATAAAAA
AATATTGATGGACAAGATATATCAGTTGCTCACACAGGAAACGTAGGAACTCCATTTTAT
ATGCCACCTGAATAGCAAGATAAATCAGGAAAATACAATGAAAAGATCGATGTGTATTCT
CTTGGTATCATTTTGTTAGAAATAATTCATAAAATGGATACATACCATGAAAAGCTTGAA
ATAGTGAAAAAGTTAAAAGGTTCCTAGGAATTGCCTAAAAATTTGCAAAAAACTTAAAAG
TATGCATGTGAGCTTATTATTTAAATGACAAGCTTAAAACCATAAAACAGACCATCAATA
GAATAAATTTTGCAAGGAAAAACTTATATGTAATGGAAAAAAAAAGCTTTGAACTTGGAT
AAGGTTTATTGA


>TTHERM_00052540(protein)
MQLNNGSIAFDNQQLNSQTQRVEENQGSLLSNLLSIIFSEQNLIALVIFLIGYFVGRRKR
NKPLKNDEVQIQNEELQNKIFNSDSSQQGVTSTKQTFNIEQNRSDFTGLNFDQNSFSQRG
VIESRKYSNQSGGNYNEDISSANSDISFQNNENQVKNTHKNSYLEDHFEDNNLSSQGKSA
VKNESQVSNENSKQLIQQSQQIKFGSDNQSSENQYKHYQGELALVPFKQNGNSNYYNNNI
HNMQNQLMIDNGSCSDNKSSSQAQQPLQRKLLNDIGSALVKKKARHNKMYGLSEESEEEL
LFEQCTFKNPPLRKKADFKIEFEQDDAKGVYRKIETHQVITDYVQTKEIHKEIEEIKQTF
SSQFQIKENQNVNGFKMSLVKQNLQVIPMLEKMKSQSISEINNLNDSAQRGQFNSYEKEQ
QLALYMKSPFEVETRISPLYEQSHIKQYLDNGKFNKFFRVIDELGRGGFGRVYKVQSMVE
EKIYAIKKIAVPYDGFSNPKEHKYFREVKSIMSLNHINIVRYHTSWWENCDDEMVNQVNE
FLQTNNNLYSDDNSPSVSEAYQKNKSDYNRSYALSKQTNQTQSYVLSYNNDNLSCIEWEQ
SENENQNPNISNNDGIKKKLDDSQTINEYREQNKSHKTFNFTKEPSQLLTLYIQLEYCSG
KTLRNYLDEQTHGLDSKEAFQIFSQMLEGVNYLHKNQIIHRDLKQIIYLLLYFQFKQQKI
QNRPSNILFENKIAKIADFGLSIQQELGLINANQELPSQKNIDGQDISVAHTGNVGTPFY
MPPEQQDKSGKYNEKIDVYSLGIILLEIIHKMDTYHEKLEIVKKLKGSQELPKNLQKTQK
YACELIIQMTSLKPQNRPSIEQILQGKTYMQWKKKALNLDKVY


>TTHERM_00052540(gene)
ATGTAGCTTAATAATGGTAGTATCGCATTTGATAATCAATAGCTGAATTCTTAAACTTAG
CGAGTAGAAGAAAATTAAGGAAGTTTATTATCAAATTTATTGAGTATAATTTTTAGCGAA
TAAAATTTAATTGCATTGGTAATATTTTTAATTGGCTACTTTGTTGGAAGAAGAAAGAGA
AATAAGCCTTTAAAAAATGATGAAGTTTAAATTTAAAATGAAGAATTATAAAATAAAATA
TTTAATAGCGACTCATCATAACAAGGAGTTACATCTACAAAATAAACATTTAATATTGAG
TAAAATAGATCAGATTTTACAGGTCTGAACTTTGATTAAAATTCTTTTTCATAAAGAGGC
GTTATAGAATCTAGAAAATATTCAAACTAGAGTGGAGGAAATTACAATGAAGATATTTCT
TCTGCAAATTCTGATATTTCTTTTTAGAATAATGAAAATTAAGTGAAAAATACACATAAA
AATAGCTATTTAGAAGATCATTTTGAAGACAATAATTTATCTTCTTAGGGAAAAAGTGCA
GTGAAAAATGAAAGTCAAGTTTCAAATGAAAATTCAAAATAGCTGATATAGTAAAGCTAG
CAAATAAAGTTTGGATCAGATAATTAAAGCAGTGAAAATTAATATAAACATTATTAAGGT
GAATTAGCATTAGTTCCTTTTAAATAAAATGGAAACTCAAATTACTACAATAACAATATC
CACAATATGTAAAATTAGTTAATGATTGATAATGGTAGTTGCAGTGATAACAAGAGCTCA
AGTCAAGCCTAGTAACCTTTACAAAGAAAGTTGCTTAATGATATAGGAAGTGCTTTGGTC
AAAAAAAAAGCTAGACATAATAAAATGTATGGTTTAAGTGAAGAAAGTGAGGAAGAATTA
CTTTTTGAGTAGTGTACCTTTAAGAATCCGCCATTGAGAAAGAAGGCAGATTTTAAAATT
GAATTCGAGTAAGATGATGCTAAGGGAGTATATAGAAAGATAGAAACACACTAAGTTATT
ACTGACTATGTATAAACTAAAGAAATTCATAAAGAAATAGAAGAGATTAAGTAGACTTTC
TCATCATAATTCTAAATTAAAGAGAATCAAAATGTAAACGGCTTTAAGATGTCTCTTGTG
AAATAAAATTTATAAGTTATTCCCATGTTGGAAAAAATGAAAAGCTAAAGTATTTCAGAA
ATAAATAACCTAAACGATAGCGCTTAGCGTGGACAATTTAATTCTTATGAGAAGGAACAG
CAACTTGCTTTATATATGAAATCACCTTTTGAAGTTGAAACAAGAATTTCACCCCTTTAT
GAACAAAGTCATATCAAACAATATTTAGATAATGGCAAATTCAACAAATTCTTTAGAGTA
ATAGATGAATTAGGAAGAGGAGGTTTCGGAAGAGTTTATAAGGTGCAAAGTATGGTTGAA
GAAAAAATCTATGCAATAAAAAAAATAGCTGTTCCCTATGATGGATTTTCAAATCCAAAA
GAGCATAAGTATTTCAGAGAAGTAAAGAGTATTATGAGTCTTAATCACATCAACATTGTT
AGGTAATTTGATATTTTCATTCTATATTTTAGTAAATAAAACTAACTTTGAGACAACGAT
TATATAAAATATTAATTCTTTTAAATTTCTTAAATTTTTTAATAAGTTTGAAAATATTTT
TTTTTAAATTAATTTTAGATATCACACAAGCTGGTGGGAAAATTGTGATGACGAAATGGT
AAATTAAGTCAACGAATTCTTATAGACAAATAATAATTTATACTCTGATGACAATAGTCC
TTCTGTTTCTGAAGCTTATTAAAAAAATAAAAGTGACTACAACAGATCTTATGCACTCTC
AAAACAAACTAACCAGACTCAGTCTTATGTTTTAAGCTACAATAATGATAATCTTTCTTG
TATAGAATGGGAATAGTCAGAAAATGAAAATCAAAACCCTAATATTTCTAACAATGATGG
GATAAAAAAGAAATTAGATGACTCTCAAACAATAAATGAATATCGTGAATAAAATAAAAG
TCATAAGACTTTTAATTTTACAAAAGAACCTTCTTAATTGCTAACCTTATACATACAAGT
ATTTTTATACAGTATATTTAAATTAAATTTAAAAAAAATAATTTTATTATAAAAGCTTGA
ATATTGCTCAGGAAAAACTTTAAGAAATTACCTTGATGAATAAACTCATGGATTAGACAG
CAAAGAAGCCTTCCAAATATTTTCTTAAATGTTAGAAGGTGTAAATTATCTTCATAAAAA
CTAAATTATTCATAGAGATCTTAAGTAAATAATTTATTTATTGCTTTACTTTTAATTTAA
ATAATAAAAAATATAAAATAGACCTTCTAATATTCTGTTTGAAAACAAAATTGCAAAAAT
TGCAGATTTCGGTTTGTCGATTTAATAGGAATTAGGACTTATTAATGCTAACTAAGAATT
ACCATCATAAAAAAATATTGATGGACAAGATATATCAGTTGCTCACACAGGAAACGTAGG
AACTCCATTTTATATGCCACCTGAATAGCAAGATAAATCAGGAAAATACAATGAAAAGAT
CGATGTGTATTCTCTTGGTATCATTTTGTTAGAAATAATTCATAAAATGGATACATACCA
TGAAAAGCTTGAAATAGTGAAAAAGTTAAAAGGTTCCTAGGAATTGCCTAAAAATTTGCA
AAAAACTTAAAAGTATGCATGTGAGCTTATTATTTAAATGACAAGCTTAAAACCATAAAA
CAGACCATCAATAGAATAAATTTTGCAAGGAAAAACTTATATGTAATGGAAAAAAAAAGC
TTTGAACTTGGATAAGGTTTATTGA