Identifiers and Description

Gene Model Identifier

TTHERM_00052540

Standard Name

None

Aliases

PreTt11434 | 3.m01819 | 3824.m03189

Description

Protein kinase domain containing protein. Sequence similarity to the GCN2 subfamily of the protein kinase PEK family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00052540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01514.19.997093137033517e-262protein kinase domain-containi
ng protein (901 aa)
OxytrichaContig9429.0.g376.002971818577897e-50Protein kinase domain
SGDYDR283C9.99723014177113e-33GCN2 Protein kinase, phosphory
lates the alpha-subunit of tra
nslation initiation factor eIF
2 (Sui2p) in response to starv
ation; activated by uncharged
tRNAs and the Gcn1p-Gcn20p com
plex; contributes to DNA damag
e checkpoint control
DictyBaseDDB_G02768291.000137892321693e-31ifkB on chromosome: 2 position
7412574 to 7416650
WormBaseWBGene000039701.9999391735788327e-19locus:pek-1 Eukaryotic trans
lation initiation factor 2-alp
ha kinase status:Confirmed
UniProt:Q19192 protein_id:C
AA91470.1
Stentor CoeruleusSteCoe_143260.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052540(coding)
ATGTAGCTTAATAATGGTAGTATCGCATTTGATAATCAATAGCTGAATTCTTAAACTTAG
CGAGTAGAAGAAAATTAAGGAAGTTTATTATCAAATTTATTGAGTATAATTTTTAGCGAA
TAAAATTTAATTGCATTGGTAATATTTTTAATTGGCTACTTTGTTGGAAGAAGAAAGAGA
AATAAGCCTTTAAAAAATGATGAAGTTTAAATTTAAAATGAAGAATTATAAAATAAAATA
TTTAATAGCGACTCATCATAACAAGGAGTTACATCTACAAAATAAACATTTAATATTGAG
TAAAATAGATCAGATTTTACAGGTCTGAACTTTGATTAAAATTCTTTTTCATAAAGAGGC
GTTATAGAATCTAGAAAATATTCAAACTAGAGTGGAGGAAATTACAATGAAGATATTTCT
TCTGCAAATTCTGATATTTCTTTTTAGAATAATGAAAATTAAGTGAAAAATACACATAAA
AATAGCTATTTAGAAGATCATTTTGAAGACAATAATTTATCTTCTTAGGGAAAAAGTGCA
GTGAAAAATGAAAGTCAAGTTTCAAATGAAAATTCAAAATAGCTGATATAGTAAAGCTAG
CAAATAAAGTTTGGATCAGATAATTAAAGCAGTGAAAATTAATATAAACATTATTAAGGT
GAATTAGCATTAGTTCCTTTTAAATAAAATGGAAACTCAAATTACTACAATAACAATATC
CACAATATGTAAAATTAGTTAATGATTGATAATGGTAGTTGCAGTGATAACAAGAGCTCA
AGTCAAGCCTAGTAACCTTTACAAAGAAAGTTGCTTAATGATATAGGAAGTGCTTTGGTC
AAAAAAAAAGCTAGACATAATAAAATGTATGGTTTAAGTGAAGAAAGTGAGGAAGAATTA
CTTTTTGAGTAGTGTACCTTTAAGAATCCGCCATTGAGAAAGAAGGCAGATTTTAAAATT
GAATTCGAGTAAGATGATGCTAAGGGAGTATATAGAAAGATAGAAACACACTAAGTTATT
ACTGACTATGTATAAACTAAAGAAATTCATAAAGAAATAGAAGAGATTAAGTAGACTTTC
TCATCATAATTCTAAATTAAAGAGAATCAAAATGTAAACGGCTTTAAGATGTCTCTTGTG
AAATAAAATTTATAAGTTATTCCCATGTTGGAAAAAATGAAAAGCTAAAGTATTTCAGAA
ATAAATAACCTAAACGATAGCGCTTAGCGTGGACAATTTAATTCTTATGAGAAGGAACAG
CAACTTGCTTTATATATGAAATCACCTTTTGAAGTTGAAACAAGAATTTCACCCCTTTAT
GAACAAAGTCATATCAAACAATATTTAGATAATGGCAAATTCAACAAATTCTTTAGAGTA
ATAGATGAATTAGGAAGAGGAGGTTTCGGAAGAGTTTATAAGGTGCAAAGTATGGTTGAA
GAAAAAATCTATGCAATAAAAAAAATAGCTGTTCCCTATGATGGATTTTCAAATCCAAAA
GAGCATAAGTATTTCAGAGAAGTAAAGAGTATTATGAGTCTTAATCACATCAACATTGTT
AGATATCACACAAGCTGGTGGGAAAATTGTGATGACGAAATGGTAAATTAAGTCAACGAA
TTCTTATAGACAAATAATAATTTATACTCTGATGACAATAGTCCTTCTGTTTCTGAAGCT
TATTAAAAAAATAAAAGTGACTACAACAGATCTTATGCACTCTCAAAACAAACTAACCAG
ACTCAGTCTTATGTTTTAAGCTACAATAATGATAATCTTTCTTGTATAGAATGGGAATAG
TCAGAAAATGAAAATCAAAACCCTAATATTTCTAACAATGATGGGATAAAAAAGAAATTA
GATGACTCTCAAACAATAAATGAATATCGTGAATAAAATAAAAGTCATAAGACTTTTAAT
TTTACAAAAGAACCTTCTTAATTGCTAACCTTATACATACAACTTGAATATTGCTCAGGA
AAAACTTTAAGAAATTACCTTGATGAATAAACTCATGGATTAGACAGCAAAGAAGCCTTC
CAAATATTTTCTTAAATGTTAGAAGGTGTAAATTATCTTCATAAAAACTAAATTATTCAT
AGAGATCTTAAGTAAATAATTTATTTATTGCTTTACTTTTAATTTAAATAATAAAAAATA
TAAAATAGACCTTCTAATATTCTGTTTGAAAACAAAATTGCAAAAATTGCAGATTTCGGT
TTGTCGATTTAATAGGAATTAGGACTTATTAATGCTAACTAAGAATTACCATCATAAAAA
AATATTGATGGACAAGATATATCAGTTGCTCACACAGGAAACGTAGGAACTCCATTTTAT
ATGCCACCTGAATAGCAAGATAAATCAGGAAAATACAATGAAAAGATCGATGTGTATTCT
CTTGGTATCATTTTGTTAGAAATAATTCATAAAATGGATACATACCATGAAAAGCTTGAA
ATAGTGAAAAAGTTAAAAGGTTCCTAGGAATTGCCTAAAAATTTGCAAAAAACTTAAAAG
TATGCATGTGAGCTTATTATTTAAATGACAAGCTTAAAACCATAAAACAGACCATCAATA
GAATAAATTTTGCAAGGAAAAACTTATATGTAATGGAAAAAAAAAGCTTTGAACTTGGAT
AAGGTTTATTGA


>TTHERM_00052540(protein)
MQLNNGSIAFDNQQLNSQTQRVEENQGSLLSNLLSIIFSEQNLIALVIFLIGYFVGRRKR
NKPLKNDEVQIQNEELQNKIFNSDSSQQGVTSTKQTFNIEQNRSDFTGLNFDQNSFSQRG
VIESRKYSNQSGGNYNEDISSANSDISFQNNENQVKNTHKNSYLEDHFEDNNLSSQGKSA
VKNESQVSNENSKQLIQQSQQIKFGSDNQSSENQYKHYQGELALVPFKQNGNSNYYNNNI
HNMQNQLMIDNGSCSDNKSSSQAQQPLQRKLLNDIGSALVKKKARHNKMYGLSEESEEEL
LFEQCTFKNPPLRKKADFKIEFEQDDAKGVYRKIETHQVITDYVQTKEIHKEIEEIKQTF
SSQFQIKENQNVNGFKMSLVKQNLQVIPMLEKMKSQSISEINNLNDSAQRGQFNSYEKEQ
QLALYMKSPFEVETRISPLYEQSHIKQYLDNGKFNKFFRVIDELGRGGFGRVYKVQSMVE
EKIYAIKKIAVPYDGFSNPKEHKYFREVKSIMSLNHINIVRYHTSWWENCDDEMVNQVNE
FLQTNNNLYSDDNSPSVSEAYQKNKSDYNRSYALSKQTNQTQSYVLSYNNDNLSCIEWEQ
SENENQNPNISNNDGIKKKLDDSQTINEYREQNKSHKTFNFTKEPSQLLTLYIQLEYCSG
KTLRNYLDEQTHGLDSKEAFQIFSQMLEGVNYLHKNQIIHRDLKQIIYLLLYFQFKQQKI
QNRPSNILFENKIAKIADFGLSIQQELGLINANQELPSQKNIDGQDISVAHTGNVGTPFY
MPPEQQDKSGKYNEKIDVYSLGIILLEIIHKMDTYHEKLEIVKKLKGSQELPKNLQKTQK
YACELIIQMTSLKPQNRPSIEQILQGKTYMQWKKKALNLDKVY


>TTHERM_00052540(gene)
ATGTAGCTTAATAATGGTAGTATCGCATTTGATAATCAATAGCTGAATTCTTAAACTTAG
CGAGTAGAAGAAAATTAAGGAAGTTTATTATCAAATTTATTGAGTATAATTTTTAGCGAA
TAAAATTTAATTGCATTGGTAATATTTTTAATTGGCTACTTTGTTGGAAGAAGAAAGAGA
AATAAGCCTTTAAAAAATGATGAAGTTTAAATTTAAAATGAAGAATTATAAAATAAAATA
TTTAATAGCGACTCATCATAACAAGGAGTTACATCTACAAAATAAACATTTAATATTGAG
TAAAATAGATCAGATTTTACAGGTCTGAACTTTGATTAAAATTCTTTTTCATAAAGAGGC
GTTATAGAATCTAGAAAATATTCAAACTAGAGTGGAGGAAATTACAATGAAGATATTTCT
TCTGCAAATTCTGATATTTCTTTTTAGAATAATGAAAATTAAGTGAAAAATACACATAAA
AATAGCTATTTAGAAGATCATTTTGAAGACAATAATTTATCTTCTTAGGGAAAAAGTGCA
GTGAAAAATGAAAGTCAAGTTTCAAATGAAAATTCAAAATAGCTGATATAGTAAAGCTAG
CAAATAAAGTTTGGATCAGATAATTAAAGCAGTGAAAATTAATATAAACATTATTAAGGT
GAATTAGCATTAGTTCCTTTTAAATAAAATGGAAACTCAAATTACTACAATAACAATATC
CACAATATGTAAAATTAGTTAATGATTGATAATGGTAGTTGCAGTGATAACAAGAGCTCA
AGTCAAGCCTAGTAACCTTTACAAAGAAAGTTGCTTAATGATATAGGAAGTGCTTTGGTC
AAAAAAAAAGCTAGACATAATAAAATGTATGGTTTAAGTGAAGAAAGTGAGGAAGAATTA
CTTTTTGAGTAGTGTACCTTTAAGAATCCGCCATTGAGAAAGAAGGCAGATTTTAAAATT
GAATTCGAGTAAGATGATGCTAAGGGAGTATATAGAAAGATAGAAACACACTAAGTTATT
ACTGACTATGTATAAACTAAAGAAATTCATAAAGAAATAGAAGAGATTAAGTAGACTTTC
TCATCATAATTCTAAATTAAAGAGAATCAAAATGTAAACGGCTTTAAGATGTCTCTTGTG
AAATAAAATTTATAAGTTATTCCCATGTTGGAAAAAATGAAAAGCTAAAGTATTTCAGAA
ATAAATAACCTAAACGATAGCGCTTAGCGTGGACAATTTAATTCTTATGAGAAGGAACAG
CAACTTGCTTTATATATGAAATCACCTTTTGAAGTTGAAACAAGAATTTCACCCCTTTAT
GAACAAAGTCATATCAAACAATATTTAGATAATGGCAAATTCAACAAATTCTTTAGAGTA
ATAGATGAATTAGGAAGAGGAGGTTTCGGAAGAGTTTATAAGGTGCAAAGTATGGTTGAA
GAAAAAATCTATGCAATAAAAAAAATAGCTGTTCCCTATGATGGATTTTCAAATCCAAAA
GAGCATAAGTATTTCAGAGAAGTAAAGAGTATTATGAGTCTTAATCACATCAACATTGTT
AGGTAATTTGATATTTTCATTCTATATTTTAGTAAATAAAACTAACTTTGAGACAACGAT
TATATAAAATATTAATTCTTTTAAATTTCTTAAATTTTTTAATAAGTTTGAAAATATTTT
TTTTTAAATTAATTTTAGATATCACACAAGCTGGTGGGAAAATTGTGATGACGAAATGGT
AAATTAAGTCAACGAATTCTTATAGACAAATAATAATTTATACTCTGATGACAATAGTCC
TTCTGTTTCTGAAGCTTATTAAAAAAATAAAAGTGACTACAACAGATCTTATGCACTCTC
AAAACAAACTAACCAGACTCAGTCTTATGTTTTAAGCTACAATAATGATAATCTTTCTTG
TATAGAATGGGAATAGTCAGAAAATGAAAATCAAAACCCTAATATTTCTAACAATGATGG
GATAAAAAAGAAATTAGATGACTCTCAAACAATAAATGAATATCGTGAATAAAATAAAAG
TCATAAGACTTTTAATTTTACAAAAGAACCTTCTTAATTGCTAACCTTATACATACAAGT
ATTTTTATACAGTATATTTAAATTAAATTTAAAAAAAATAATTTTATTATAAAAGCTTGA
ATATTGCTCAGGAAAAACTTTAAGAAATTACCTTGATGAATAAACTCATGGATTAGACAG
CAAAGAAGCCTTCCAAATATTTTCTTAAATGTTAGAAGGTGTAAATTATCTTCATAAAAA
CTAAATTATTCATAGAGATCTTAAGTAAATAATTTATTTATTGCTTTACTTTTAATTTAA
ATAATAAAAAATATAAAATAGACCTTCTAATATTCTGTTTGAAAACAAAATTGCAAAAAT
TGCAGATTTCGGTTTGTCGATTTAATAGGAATTAGGACTTATTAATGCTAACTAAGAATT
ACCATCATAAAAAAATATTGATGGACAAGATATATCAGTTGCTCACACAGGAAACGTAGG
AACTCCATTTTATATGCCACCTGAATAGCAAGATAAATCAGGAAAATACAATGAAAAGAT
CGATGTGTATTCTCTTGGTATCATTTTGTTAGAAATAATTCATAAAATGGATACATACCA
TGAAAAGCTTGAAATAGTGAAAAAGTTAAAAGGTTCCTAGGAATTGCCTAAAAATTTGCA
AAAAACTTAAAAGTATGCATGTGAGCTTATTATTTAAATGACAAGCTTAAAACCATAAAA
CAGACCATCAATAGAATAAATTTTGCAAGGAAAAACTTATATGTAATGGAAAAAAAAAGC
TTTGAACTTGGATAAGGTTTATTGA