Identifiers and Description

Gene Model Identifier

TTHERM_00052430

Standard Name

None

Aliases

PreTt11423 | 3.m01711 | 3824.m03178

Description

pseudouridine synthase and archaeosine transglycosylase domain protein; uncharacterized domain 2 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00052430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01527.11.9992982665753866e-121hypothetical protein (187 aa)
OxytrichaContig12322.0.g181.9991939848149086e-44PUA domain
SGDYER007C9.99893167504554e-35-A TMA20 Protein of unknown fu
nction that associates with ri
bosomes and has a putative RNA
binding domain; interacts wit
h Tma22p; null mutant exhibits
translation defects; has homo
logy to human oncogene MCT-1
WormBaseWBGene000157032.0003218023735366e-33status:Confirmed UniProt:Q8M
XH7 protein_id:CCD64247.1
DictyBaseDDB_G02719105.001425520048966e-32DDB_G0271910 on chromosome: 2
position 1018193 to 1019142

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052430(coding)
ATGTTCAAGAAAGTAGAAGAAGTTAGCAATTTAGTTCCCTTAAATAAATCAGCTTAAAAA
AAGCTCAGGGAAAAAATATTAGAAAAATTCCCTAAAATTGAAGGTGTTTTAGAAGATTTT
ATGCCCAAAAAGGCTCAAATTAGCAGCACTAAATTCCACACTCCTGAACATAAATGGGAA
TTGTTTTGGGTTGATAAGTTCCCCATTTTCTTTAAGAACGATAAAGAAGATGATGAACTC
TTCCCTACTTTAAGATTATTACACACTTATCCAGATATGCTTTTAAAATGTTAAACTGAT
TCTGGTGCTGTTAAATTTATTTTGAATGGATCTAATGTTATGGCAAAAGGTTTATAAACT
CCTGGTTCTAATGTTGAGGAAGGTGTTGAGTATGGTAAGGTTGTTGCTATATATGCCGAT
GGAAAAGAACATGCTATGGGTGTTGGAGTCGCTATCTTGAATGCCTAAGGAATTAAAGAA
GCCGCTATGGGAGAAGCTATTGTTACAAAGCACGTAATTGGTGATGGTCTCTGGTTAATA
TAGGAACCTAAAAAGAAATGA


>TTHERM_00052430(protein)
MFKKVEEVSNLVPLNKSAQKKLREKILEKFPKIEGVLEDFMPKKAQISSTKFHTPEHKWE
LFWVDKFPIFFKNDKEDDELFPTLRLLHTYPDMLLKCQTDSGAVKFILNGSNVMAKGLQT
PGSNVEEGVEYGKVVAIYADGKEHAMGVGVAILNAQGIKEAAMGEAIVTKHVIGDGLWLI
QEPKKK


>TTHERM_00052430(gene)
ATGTTCAAGAAAGTAGAAGAAGTTAGCAATTTAGTTCCCTTAAATAAATCAGCTTAAAAA
AAGCTCAGGGAAAAAATATTAGAAAAATTCCCTAAAATTGAAGGTGTTTTAGAAGATTTT
ATGCCCAAAAAGGCTCAAATTAGCAGCACTAAATTCCACACTCCTGAACATAAATGGGAA
TTGTTTTGGGTTGATAAGTTCCCCATTTTCTTTAAGAACGATAAAGAAGATGATGAACTC
TTCCCTACTTTAAGATTATTACACACTTATCCAGATATGCTTTTAAAATGTTAAACTGAT
TCTGGTGCTGTTAAATTTATTTTGAATGGATCTAATGTTATGGCAAAAGGTTTATAAACT
CCTGGTTCTAATGTTGAGGAAGGTGTTGAGTATGGTAAGGTTGTTGCTATATATGCCGAT
GGAAAAGAACATGCTATGGGTGTTGGAGTCGCTATCTTGAATGCCTAAGGAATTAAAGAA
GCCGCTATGGGAGAAGCTATTGTTACAAAGCACGTAATTGGTGATGGTCTCTGGTTAATA
TAGGAACCTAAAAAGAAATGA