Identifiers and Description

Gene Model Identifier

TTHERM_00052360

Standard Name

None

Aliases

PreTt11416 | 3.m01714 | 3824.m03171

Description

Myb-like DNA-binding domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 27%

TetraMine Data

TTHERM_00052360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01533.19.997093137033517e-262myb-like DNA-binding domain-co
ntaining protein (883 aa)
OxytrichaContig6866.0.1.g152.0003218023735366e-33Myb-like DNA-binding domain
DictyBaseDDB_G02939001.9996410647472548e-29mybA on chromosome: 6 position
3493719 to 3497607
Stentor CoeruleusSteCoe_197780.000000000000004658886145103398
SGDYKR099W0.00000000039982266684865623BAS1 Myb-related transcription
factor involved in regulating
basal and induced expression
of genes of the purine and his
tidine biosynthesis pathways;
also involved in regulation of
meiotic recombination at spec
ific genes
WormBaseWBGene000015680.0000000006999585478469937locus:snpc-4 status:Partiall
y_confirmed UniProt:O62208
protein_id:CAB04248.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052360(coding)
ATGTCACTATTTGGTATTTTCGCTAGTTGTGGAATCTGCTGCAACAGTGAAGACAAGCGA
GAATAGTAACAAAACCTCAGCAATTCTCAAAATTCAAATCCTGACCGTGTCAGGTAGCTG
ATTTTAGAAAGCTAAAGGCAAAATAATCTTACAAATAGCGGAACTTATGCAAATAATTAA
AATACAGCCTAAAACATAGAAGATCCAGACGGATTTATTGAAATTACCCCCATTTTTAAT
GGTCCAAAATCTGGATCTGGATCAGGCTCTGAGGTTGAAGAGGATTATTGTGAGATAATT
TAAGAGGTTAATACAAGTTCTAGGCAATCTTCATCTTCTTCCAGGAACTCACAAAAAGAA
ACAAGTTAAGTTTATCAAGAATTTGTTTCTTTGCCAATAAAAAAATCTAAAAGAAGAAAC
GATTAACTTCATGGAGCAAGTGGAAGCGGAAATGATATGTCTTATAAAGCTTCAATGAGA
TCTCGTAACAGTTCATCCCATTCTTAAGATGGTGGTAGCTAGTCACGTTTAGAAAAGCAA
TCAAAGCGTAGTACTAAAGCATGGACTGAGGAAGAAGATAGACTTCTTCGTTTCTATTAT
AGTAAGCATAATGGCAAGTGGCCAGCTATTGCTAATGAGATGGCAGATAGAAATGCCTCC
TAATGTTCCTAGAGATGGAGAAGAATTAAGCCTTCGAAAATCAGAAGGCCATGGACTCCT
GAAGAGGATAATATGGTTTTAGCTCTTATTAAATAACATGGTAAAAACTGGGGATTGATA
TCATCACAAATGGATAATAGAAGTGGTAAATAGGTTCGTGAAAGATATATAAACAAACTA
GATCCAGAATTAAATAATGGCTAGTTCAACGAAGAAGAAGACAGAATAATCATTGATAAA
TACTACAAGATTGGTCCTAAGTGGAGTGAAATTGCAAAATTTTTATAAGGAAGATCAGAG
AACATGGTCAAGAATCGTTTTTACTCATATATTAAAAAGACCTATGCAATCAATTCTTTG
CAAGGAAGTAACGGTGTTCGCTCTGATAATGGTTAATTGTATGATATGAATTCTTCTCCT
AGGTTAAATAATGAAAATGATAGAGCAAGCAGCTATGCTTCTTCTTTATACAACGATTTA
GATCCTTCCATAAACAGCGGAAATATTGAAAGTGAAGAAAGCTCCTCAGAAGGCGAATAA
TACAATTAATTTTAATTAGGTTTCAACTAATAAGGATTAGCAATAAATAATTAAGGATTA
GGTTTAGTAGATGATAAAAAAGTGATGAATAGTTTTAACAATAATATGAATAAGTACTAA
GATGATATTTATAAGCAACAAGATCCAATGTATTTTTAGTCATAGCAATAAAATAATCAG
TTTTTTTAGAACATGCCAATATAATAATAAAATAATATTTTGATTTAGAATAATTAGTAA
AATAGCCAATAGCAAAATTAGTAATAGTTCTATATGCTTAACTAAGAAAACCAATAATCA
GGTATGAACTAGTACTAGAACTAAAATAAGCATAATTTACCTTAAACAATGGTTAGCAGC
TAAGATTACATCAAAAGAAACAATTAATACAAGAAGATTGAGAATGAAAAAGTTGAGGAG
ATGTTTCACACTCCTCGTTTGGCTCTTGCTAACAACTCTTCTTTCTTCCCTTCTGATATC
TTCATTTAGTAATAAAAGCTTTAGCAAGACGAAATCATGAATTCAAATGGCTAATAATCA
TTGGGAAACAACTTTTTCAACACATCTCCTTCTCCTCTTATTCTTTTAAGTCCTGCTTAA
ATGAAAACAGAGTAATTTTCTTTTACTTCAAATACTCCAGGAAGAAGGTTTTTGGTTTCA
AATTCTAATACTCCTTATACAAATAACATAAGCTCTCAACAAAATAATGTTCATTTCAAT
TTCAATAACATAGCATCTACTCCTAACTATTAATTAGGCAATTAGTCATCTTAACCCTAA
TATCAAAACAACAATTATAATTAAAATTATATATAAAATCAAACCAATTAGCAATATTAG
CAGTAAATGTCATCATAAAGCTAAATGATGGATTCTACTGGTCTCAACTAGTAAATCTTT
AGTTTTTAGAATCACAACAATTAAGTGAATAATCCTAACCAATTAAAAGAAAAAATAGAA
GATACCTTTGATCATTTGAACATTAACACAAATAATAATAATAATAATAATAATAATAAT
GTTAATAACAATAATTATTATAATAATAATAACTTTGGATAAGGTTCTCAACAAAATCCT
CATGGAAACTACTACTTACCTAATATTCCCCAAGGATAAAATTTAAATGAATACTCTCAG
CCTATGTACTTTTAGCAAGGAGGTGATCAATAAATGACTTAATAGTAATTTTAATAAAAT
CAGCAATATTAGCAAAATAATTTAAATAGAAATTAAAGCAATCGTGAAGAACTAAGGCTA
GATATATCTTGTACAGATAATCGTTAAAAGTTAGAGGATCCTTAACAAAGTAATAATAAC
ACTAACAATCTAATCCCATTAGCTACACCTAAAATTGATAGAAAGCAACTAAAAAATATG
ATAGTAGATCTTGAATCTTAACTTTAACTTCTTAAAGTATAATAACAATTCTTGAATGAT
GAAGATTCAAATTGA


>TTHERM_00052360(protein)
MSLFGIFASCGICCNSEDKREQQQNLSNSQNSNPDRVRQLILESQRQNNLTNSGTYANNQ
NTAQNIEDPDGFIEITPIFNGPKSGSGSGSEVEEDYCEIIQEVNTSSRQSSSSSRNSQKE
TSQVYQEFVSLPIKKSKRRNDQLHGASGSGNDMSYKASMRSRNSSSHSQDGGSQSRLEKQ
SKRSTKAWTEEEDRLLRFYYSKHNGKWPAIANEMADRNASQCSQRWRRIKPSKIRRPWTP
EEDNMVLALIKQHGKNWGLISSQMDNRSGKQVRERYINKLDPELNNGQFNEEEDRIIIDK
YYKIGPKWSEIAKFLQGRSENMVKNRFYSYIKKTYAINSLQGSNGVRSDNGQLYDMNSSP
RLNNENDRASSYASSLYNDLDPSINSGNIESEESSSEGEQYNQFQLGFNQQGLAINNQGL
GLVDDKKVMNSFNNNMNKYQDDIYKQQDPMYFQSQQQNNQFFQNMPIQQQNNILIQNNQQ
NSQQQNQQQFYMLNQENQQSGMNQYQNQNKHNLPQTMVSSQDYIKRNNQYKKIENEKVEE
MFHTPRLALANNSSFFPSDIFIQQQKLQQDEIMNSNGQQSLGNNFFNTSPSPLILLSPAQ
MKTEQFSFTSNTPGRRFLVSNSNTPYTNNISSQQNNVHFNFNNIASTPNYQLGNQSSQPQ
YQNNNYNQNYIQNQTNQQYQQQMSSQSQMMDSTGLNQQIFSFQNHNNQVNNPNQLKEKIE
DTFDHLNINTNNNNNNNNNNVNNNNYYNNNNFGQGSQQNPHGNYYLPNIPQGQNLNEYSQ
PMYFQQGGDQQMTQQQFQQNQQYQQNNLNRNQSNREELRLDISCTDNRQKLEDPQQSNNN
TNNLIPLATPKIDRKQLKNMIVDLESQLQLLKVQQQFLNDEDSN


>TTHERM_00052360(gene)
ATGTCACTATTTGGTATTTTCGCTAGTTGTGGAATCTGCTGCAACAGTGAAGACAAGCGA
GAATAGTAACAAAACCTCAGCAATTCTCAAAATTCAAATCCTGACCGTGTCAGGTAGCTG
ATTTTAGAAAGCTAAAGGCAAAATAATCTTACAAATAGCGGAACTTATGCAAATAATTAA
AATACAGCCTAAAACATAGAAGATCCAGACGGATTTATTGAAATTACCCCCATTTTTAAT
GGTCCAAAATCTGGATCTGGATCAGGCTCTGAGGTTGAAGAGGATTATTGTGAGATAATT
TAAGAGGTTAATACAAGTTCTAGGCAATCTTCATCTTCTTCCAGGAACTCACAAAAAGAA
ACAAGTTAAGTTTATCAAGAATTTGTTTCTTTGCCAATAAAAAAATCTAAAAGAAGAAAC
GATTAACTTCATGGAGCAAGTGGAAGCGGAAATGATATGTCTTATAAAGCTTCAATGAGA
TCTCGTAACAGTTCATCCCATTCTTAAGATGGTGGTAGCTAGTCACGTTTAGAAAAGCAA
TCAAAGCGTAGTACTAAAGCATGGACTGAGGAAGAAGATAGACTTCTTCGTTTCTATTAT
AGTAAGCATAATGGCAAGTGGCCAGCTATTGCTAATGAGATGGCAGATAGAAATGCCTCC
TAATGTTCCTAGAGATGGAGAAGAATTAAGCCTTCGAAAATCAGAAGGCCATGGACTCCT
GAAGAGGATAATATGGTTTTAGCTCTTATTAAATAACATGGTAAAAACTGGGGATTGATA
TCATCACAAATGGATAATAGAAGTGGTAAATAGGTTCGTGAAAGGTAATTATTTATCAAG
CCTTACTAACAAATTCTTTAATATATAAAAACTTACCTTTTTATAAAGATTTATACTCTT
CTTTCTTCACCAACATATTCTCACTTTATCTCCTATCATTTGGATTTTAAAGTAATATTG
TGCTCTACTAAATTAAAAATTTGTTTGATACTTTTCATTAAAATGAGTGAATTTGCCTTA
AAAGCAAATTTGGATTAAGTTTAGTGAAAATTTGGTCATAGCAAATTTCAAGTTGTGAGA
AAATAAGTTCGTTTTATGCTATCAATTTAAAACGAATATTTAAGATTCCAAAATAAAAAG
GAATTAGTTTAGCAATTGGTTCAAAGGGAATAATTCTTTCTCATAAATCTAATTTTTTAA
AGATTCTCATACTTTCAATTTATTTTAAAAAACATTATTTGTATTTTTAAAATAAATATT
ATTAAATTGGTGAAATTTATTTATGGAAAGGGAAAATACTTAATTGCTTATTTCGAACTA
AACATTAGAAAATTTATATTACATCAGTAAAAGAAGAGTTAAAATTTAAAATATGAATTT
TTAAATGAATTAAATTAATTTAATAAACGGATAATAAATTTATTTTTATATAATTTAGAT
ATATAAACAAACTAGATCCAGAATTAAATAATGGCTAGTTCAACGAAGAAGAAGACAGAA
TAATCATTGATAAATACTACAAGATTGGTCCTAAGTGGAGTGAAATTGCAAAATTTTTAT
AAGGAAGATCAGAGAACATGGTCAAGAATCGTTTTTACTCATATATTAAAAAGACCTATG
CAATCAATTCTTTGCAAGGAAGTAACGGTGTTCGCTCTGATAATGGTTAATTGTATGATA
TGAATTCTTCTCCTAGGTTAAATAATGAAAATGATAGAGCAAGCAGCTATGCTTCTTCTT
TATACAACGATTTAGATCCTTCCATAAACAGCGGAAATATTGAAAGTGAAGAAAGCTCCT
CAGAAGGCGAATAATACAATTAATTTTAATTAGGTTTCAACTAATAAGGATTAGCAATAA
ATAATTAAGGATTAGGTTTAGTAGATGATAAAAAAGTGATGAATAGTTTTAACAATAATA
TGAATAAGTACTAAGATGATATTTATAAGCAACAAGATCCAATGTATTTTTAGTCATAGC
AATAAAATAATCAGTTTTTTTAGAACATGCCAATATAATAATAAAATAATATTTTGATTT
AGAATAATTAGTAAAATAGCCAATAGCAAAATTAGTAATAGTTCTATATGCTTAACTAAG
AAAACCAATAATCAGGTATGAACTAGTACTAGAACTAAAATAAGCATAATTTACCTTAAA
CAATGGTTAGCAGCTAAGATTACATCAAAAGAAACAATTAATACAAGAAGATTGAGAATG
AAAAAGTTGAGGAGATGTTTCACACTCCTCGTTTGGCTCTTGCTAACAACTCTTCTTTCT
TCCCTTCTGATATCTTCATTTAGTAATAAAAGCTTTAGCAAGACGAAATCATGAATTCAA
ATGGCTAATAATCATTGGGAAACAACTTTTTCAACACATCTCCTTCTCCTCTTATTCTTT
TAAGTCCTGCTTAAATGAAAACAGAGTAATTTTCTTTTACTTCAAATACTCCAGGAAGAA
GGTTTTTGGTTTCAAATTCTAATACTCCTTATACAAATAACATAAGCTCTCAACAAAATA
ATGTTCATTTCAATTTCAATAACATAGCATCTACTCCTAACTATTAATTAGGCAATTAGT
CATCTTAACCCTAATATCAAAACAACAATTATAATTAAAATTATATATAAAATCAAACCA
ATTAGCAATATTAGCAGTAAATGTCATCATAAAGCTAAATGATGGATTCTACTGGTCTCA
ACTAGTAAATCTTTAGTTTTTAGAATCACAACAATTAAGTGAATAATCCTAACCAATTAA
AAGAAAAAATAGAAGATACCTTTGATCATTTGAACATTAACACAAATAATAATAATAATA
ATAATAATAATAATGTTAATAACAATAATTATTATAATAATAATAACTTTGGATAAGGTT
CTCAACAAAATCCTCATGGAAACTACTACTTACCTAATATTCCCCAAGGATAAAATTTAA
ATGAATACTCTCAGCCTATGTACTTTTAGCAAGGAGGTGATCAATAAATGACTTAATAGT
AATTTTAATAAAATCAGCAATATTAGCAAAATAATTTAAATAGAAATTAAAGCAATCGTG
AAGAACTAAGGCTAGATATATCTTGTACAGATAATCGTTAAAAGTTAGAGGATCCTTAAC
AAAGTAATAATAACACTAACAATCTAATCCCATTAGCTACACCTAAAATTGATAGAAAGC
AACTAAAAAATATGATAGTAGATCTTGAATCTTAACTTTAACTTCTTAAAGTATAATAAC
AATTCTTGAATGATGAAGATTCAAATTGA