Identifiers and Description

Gene Model Identifier

TTHERM_00049200

Standard Name

None

Aliases

PreTt11299 | 3.m01707 | 3824.m03058

Description

WD40 domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00049200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01638.19.997093137033517e-262hypothetical protein (347 aa)
OxytrichaContig3164.0.g435.999266750653237e-78WD domain, G-beta repeat
Stentor CoeruleusSteCoe_330273.6251409191435593e-34
DictyBaseDDB_G02884530.0000000000000700196834671948DDB_G0288453 on chromosome: 5
position 1521809 to 1525011
WormBaseWBGene000110510.000000000010004361180063202locus:pfs-2 status:Partially
_confirmed UniProt:U4PCM1
protein_id:CDH93484.1
SGDYGL137W0.000000009996807949091551SEC27 Essential beta-coat prot
ein of the COPI coatomer, invo
lved in ER-to-Golgi and Golgi-
to-ER transport; contains WD40
domains that mediate cargo se
lective interactions; 45% sequ
ence identity to mammalian bet
a-COP

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00049200(coding)
ATGGATACATAAAGCTCTGTTGAGTATGATTATTTTAGACATGACGTTGTAGATGTTAAA
GGAATGGGTAAAAAGATAGTCAAAAAAAACATTTTCAATACAGAATCTCCTATTATGAAT
TTAAGATTTGATCCCGAAGACACAATGATTGCTGCTGTTTGTGGAGATGGATCTCTAAAA
ATATTTCACTTGCATTCAGATTAGCTTAAGGTAAAAGTAAAAACAGGAAAACCAAATATG
AATGTGCCAGCTACTTGTTTAAGATGGAGACCAACAGCTTTTTCGGCCTCTACTAAGAAT
GTAATAGTGACAGGAGGAGCTGATGGGTAGTTAGTACACTGGCATGTAACCACAGGAAAG
GAACTCAATAGGATAGAAGAAAAAGGAAATCAAATTAACTCTATAGATTACAACAAAGAT
GGAAGTCGCTTTATAACTTCTGGAAGTGATAATAAAATTAGATTATATGATGAAAATGAA
AAATCTTTAGTATCAGAGTACAAAGGTTCAGAATGGCAAGATCCAGGACACAATAACAGA
ATTTTTTCATTAAAATTTTTACCAGATGATCCTAATTTATTCATAAGTGGAGGTTGGGAT
ACGAATGTACATATATGGGATATAAGACAAGGGAAATCAGTAGGAGGATTTATAGGACCC
AAAATAGGAGGTGATTCATTAGATTATCAAAATGGACATATTTTAACAGGTGCAAATAGA
TCTAGAGATTAATTACAAATATGGGATTTTAAGTAAAGAACTTTAATTAGAACAGTTGAT
TGGAATTATGGTAAAAAAGAAGACACTGGAGCTTTTGTTTATGGTTGTCAATTCAGCAAA
TGCAATTCAGATAGCATTATTGCTGGTTCATTTGGTTTAAATGAAGTTAGGCTCTTTGAC
TAAAATAAAGATTATCAACCTTATGGATACGTAACAGGATTTAAAAAGGGAATATATTCT
GTTGATTTTGGTAATTTCTCTAACAAATTCGCATTTGGTGGTGAAGATGGAGGAATATTT
GTAATGTCTGTTACAGCAGCTTGA


>TTHERM_00049200(protein)
MDTQSSVEYDYFRHDVVDVKGMGKKIVKKNIFNTESPIMNLRFDPEDTMIAAVCGDGSLK
IFHLHSDQLKVKVKTGKPNMNVPATCLRWRPTAFSASTKNVIVTGGADGQLVHWHVTTGK
ELNRIEEKGNQINSIDYNKDGSRFITSGSDNKIRLYDENEKSLVSEYKGSEWQDPGHNNR
IFSLKFLPDDPNLFISGGWDTNVHIWDIRQGKSVGGFIGPKIGGDSLDYQNGHILTGANR
SRDQLQIWDFKQRTLIRTVDWNYGKKEDTGAFVYGCQFSKCNSDSIIAGSFGLNEVRLFD
QNKDYQPYGYVTGFKKGIYSVDFGNFSNKFAFGGEDGGIFVMSVTAA


>TTHERM_00049200(gene)
ATGGATACATAAAGCTCTGTTGAGTATGATTATTTTAGACATGAGTAATTATTTTTATTG
ATATTGTAGGATTTGATAAAAATTTATTCTTCGACCTTGTTTTTATCTGTTCTATTCTTT
AAAAAATTTCAAAATTATTTTCTTAAATTTATCATTTTAATTAGCGTTGTAGATGTTAAA
GGAATGGGTAAAAAGATAGTCAAAAAAAACATTTTCAATACAGAATCTCCTATTATGAAT
TTAAGATTTGATCCCGAAGACACAATGATTGCTGCTGGTAATTTTGCAAATCTTACATAT
AATTATTATCAATTTAGTTTTATTATTGCGTTTTATAAATTATTGTCAAGTTTTTTAATG
AAAAAATATATTTTTGTTAAATAAAATAGTTTGTGGAGATGGATCTCTAAAAATATTTCA
CTTGCATTCAGGTAAATAATTTTAGAGTCTTTTCATCATTTTATTTTTCACAATTTGTTA
AAGATTAGCTTAAGGTAAAAGTAAAAACAGGAAAACCAAATATGAATGTGCCAGCTACTT
GTTTAAGGTAGAATAAAATTTTATTAAATAAAATCAAAGTTTATTTTTATATAAAATATA
GATGGAGACCAACAGCTTTTTCGGCCTCTACTAAGAATGTAATAGTGACAGGAGGAGCTG
ATGGGTAGTTAGTACACTGGCATGTAACCACAGGTATCTATCACTTATTTTTTTTATTTA
TTTTTAATGTAACCATAAAAAATATATAAATAAATTTAGGAAAGGAACTCAATAGGATAG
AAGAAAAAGGAAATCAAATTAACTCTATAGATTACAACAAAGATGGAAGTCGCTTTATAA
CTTCTGGAAGTGATAATAAAGTAAAATTAAATTAAAAAATTATTATTTCAATTTATTATC
AAATTAGATTAGATTATATGATGAAAATGAAAAATCTTTAGTATCAGAGTACAAAGGTTC
AGAATGGCAAGATCCAGGACACAATAACAGAATTTTTTCATTAAAATTTTTACCAGATGA
TCCTAATTTATTCATAAGTGGAGGTTGGGATACGAATGTACATATATGGGATATAAGACA
AGGGAAATCAGTAGGAGGATTTATAGGACCCAAAATAGGAGGTAGATATTTAAAATAAAT
TAAAAGTTAACAATTCTGCAATAAAAATATAGGTGATTCATTAGATTATCAAAATGGACA
TATTTTAACAGGTGCAAATAGATCTAGAGATTAATTACAAATATGGGATTTTAAGTAAAG
AACTTTAATTAGAACAGTTGATTGGAATTATGGTAAAAAAGAAGACACTGGAGCTTTTGT
TTATGGTTGTCAATTCAGCAAATGCAATTCAGATAGCATTATTGCTGGTTCATTTGGTTT
AAATGAAGTTAGGCTCTTTGACTAAAATAAAGATTATCAACCTTATGGATACGTAACAGG
ATTTAAAAAGGGAATATATTCTGTTGATTTTGGTAATTTCTCTAACAAATTCGCATTTGG
TGGTGAAGATGGAGGAATATTTGTAATGTCTGTTACAGCAGCTTGA