Identifiers and Description

Gene Model Identifier

TTHERM_00047080

Standard Name

None

Aliases

PreTt11187 | 3.m01828 | 3824.m02946

Description

succinate dehydrogenase, flavoprotein subunit containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000153919.99709313703352e-262locus:sdha-1 Succinate dehyd
rogenase [ubiquinone] flavopro
tein subunit, mitochondrial
status:Confirmed UniProt:Q09
508 protein_id:CCD62793.1
Tetrahymena borealisEI9_01749.19.99709313703352e-262succinate dehydrogenase, flavo
protein subunit containing pro
tein (637 aa)
DictyBaseDDB_G02805359.99709313703352e-262sdhA on chromosome: 3 position
3543819 to 3545699
OxytrichaContig18065.0.g819.99709313703352e-262FAD binding domain
SGDYKL148C9.99709313703352e-262SDH1 Flavoprotein subunit of s
uccinate dehydrogenase (Sdh1p,
Sdh2p, Sdh3p, Sdh4p), which c
ouples the oxidation of succin
ate to the transfer of electro
ns to ubiquinone as part of th
e TCA cycle and the mitochondr
ial respiratory chain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047080(coding)
ATGTTTAAATACTTATCTAAGATATAAAGAGTTACCTTACACAGCAAAGTTTCAAAGAAT
TTTGCAGTTTTGTCAAAGGATCATCCCGAAAAGGGACCTTCCCAAGGTCATTTGACTGAC
AAATACACTGTCATTGATCACACCTATGATGCTATCGTTGTTGGTGCTGGTGGTGCTGGT
TTAAGAGCTGCTTTTGGTTTGGTTGAAGAAGGTTTCAAGACCGCTTGTATTACTAAGCTT
TTCCCTACTCGTTCTCACACAGTCGCTGCTTAAGGTGGTATTAACGCTGCTTTAGGTAAT
ATGACAGAAGATGACTGGAAATGGCATTTTTATGATACAGTTAAGGGTTCTGATTGGTTA
GGTGATTAAGATGCTATCTAATATATGACTAGAGAAGCTCCCGCTGCCGTCTTAGAATTA
GAATCTTACGGTCTTCCCTTCTCTCGTACTCCTGAAGGCAAGATCTATCAAAGAGCCTTC
GGTGGTCAATCCCTCAAGTTCGGCAAGGGTGGTTAGGCAAGAAGAACTGCTTGTGCAGCT
GATAGAACTGGACATGCTATGTTACATACTTTATTCGGAAGATCCTTAGCTTATAATTGC
AATTTCTTTATTGAATATTTCGTTATTGACTTAATTATGGATGAAGAAGGTGCCTGCAGA
GGTGTCATCTGTATGTCTATGGCTGATGGTTCTATTCACAGAATCAGAGCCCATTACACT
GTATTGGCTGCTGGTGGTTACGGTAGATCTTATCTTTCTTGCACTGCTGCTCACACCTGC
ACTGGTGATGGTATGGCTCTTGCTACTAGAGCTGGACTTCCTCTTGAAGATCCTGAATTC
GTTTAATTCCATCCTACTGGTATCTACGGTTCTGGTTGTTTGATGACCGAAGGTTGCAGA
GGTGAAGGTGGTATCCTTGTTAACAGTAATGGTGAAGCTTTCATGGAAAAATATGCTCCC
ACTGCTAAGGATCTTGCTTCCAGAGATGTCGTCTCTAGAGCTATGACTATTGAAATCCTT
GAAGGTAGAGGTGTTGGCCCTAAGAAGGATCACATTTTCTTATAATTACATCACTTGAGT
CCTGAAACTTTACATTAGAGATTACCTGGTATTTCTGAAACTGCCAGAATTTTCGCAGGT
GTTGATGTTACCAAAGAACCAGCTCCTGTCGTTCCTACCGTTCACTACAATATGGGTGGT
GTTCCCACTAACTGGAAGACTGAAGTTATTACCCAAGACAAGAATGGAAAGGACAAGATT
GTTCCTGGTTTGCTTGCTGCTGGTGAAAACGCTTGTGCTTCTGTCCACGGTGCTAACAGA
CTTGGTGCTAACTCTCTTTTAGATATTGTCGTTTTCGGTAGAGCTGCTGCCAAACTTGTT
AAGGAAAAGCTTAAACCTGGTACTCCTCATAAGGATTTACCCAAGAATGCTGGTGAATAA
GCTTTAGCCAGATTAGATAAATACAGATTTGCTAATGGTGAATACACTACTCACCACGTT
AGAACTGCTATGTAAGAAACCATGTAACGTCACGCAGCTGTCTTCAGAATTGAAAAGCTT
ATGGCTGAAGGTGTTCAAAAATTAGATCACATTTATGAATAATCAAAGAGCCTTAAAACC
TTCGACAGAGGTCTTGTTTGGAACACTGATCTCATTGAAACCTTAGAATTAGAAAACCTT
CTTTTATGCTCTAAATAAACTCTTCTCGCTGGTTTACTCAGAAAGGAATCCAGAGGTGCT
CACGCCAGAGACGATTTTAAGGAAAGAGATGATAAGAATTGGATGAAGCACAGTCTCACT
TGGATTAAAGATGTAAATACTGGTAAAACTGAAGTAACCTATAGAGATGTCATCAACCAC
ACTCTTGATAGTGAAGTTACTCCTGTTCCTCCCGCTAAAAGATCATATTGA


>TTHERM_00047080(protein)
MFKYLSKIQRVTLHSKVSKNFAVLSKDHPEKGPSQGHLTDKYTVIDHTYDAIVVGAGGAG
LRAAFGLVEEGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHFYDTVKGSDWL
GDQDAIQYMTREAPAAVLELESYGLPFSRTPEGKIYQRAFGGQSLKFGKGGQARRTACAA
DRTGHAMLHTLFGRSLAYNCNFFIEYFVIDLIMDEEGACRGVICMSMADGSIHRIRAHYT
VLAAGGYGRSYLSCTAAHTCTGDGMALATRAGLPLEDPEFVQFHPTGIYGSGCLMTEGCR
GEGGILVNSNGEAFMEKYAPTAKDLASRDVVSRAMTIEILEGRGVGPKKDHIFLQLHHLS
PETLHQRLPGISETARIFAGVDVTKEPAPVVPTVHYNMGGVPTNWKTEVITQDKNGKDKI
VPGLLAAGENACASVHGANRLGANSLLDIVVFGRAAAKLVKEKLKPGTPHKDLPKNAGEQ
ALARLDKYRFANGEYTTHHVRTAMQETMQRHAAVFRIEKLMAEGVQKLDHIYEQSKSLKT
FDRGLVWNTDLIETLELENLLLCSKQTLLAGLLRKESRGAHARDDFKERDDKNWMKHSLT
WIKDVNTGKTEVTYRDVINHTLDSEVTPVPPAKRSY


>TTHERM_00047080(gene)
ATGTTTAAATACTTATCTAAGATATAAAGAGTTACCTTACACAGCAAAGTTTCAAAGAAT
TTTGCAGTTTTGTCAAAGGATCATCCCGAAAAGGGACCTTCCCAAGTATGCAAATATTCT
ATCTATTCATTTTTGATTGAAGGAATTGAATGCAAGTGAAGAAGGAGAGATATTAGTTAA
TAAATGAAACTTTAAAATGAAAATGGTTGGTTTCAGCGCTATTCACGTTACTAATTACTT
GCAAAAGAATAATAATTTATTCAAATAAATTTTGCTCAATATAAAATAGTTGAGTAATGG
AGCATCATACCATTTTTTACAATTTAGCAAATGCTTGCTTATTATCCCTAATATATCAAT
CAATTATATAAGCCTTAAACAACTCTCGCTACTTCTTTTGCTTTCTCTTCTAAGGATCCC
ATTCATTTTTTGTTTTAATTTAATTTTTTTGATCTAAAATCGTTTTTATTTTTAAGGGTC
ATTTGACTGACAAATACACTGTCATTGATCACACCTATGATGCTATCGTTGTTGGTGCTG
GTGGTGCTGGTTTAAGAGCTGCTTTTGGTTTGGTTGAAGAAGGTTTCAAGACCGCTTGTA
TTACTAAGCTTTTCCCTACTCGTTCTCACACAGTCGCTGCTTAAGGTGGTATTAACGCTG
CTTTAGGTAATATGACAGAAGATGACTGGAAATGGCATTTTTATGATACAGTTAAGGGTT
CTGATTGGTTAGGTGATTAAGATGCTATCTAATATATGACTAGAGAAGCTCCCGCTGCCG
TCTTAGAATTAGAATCTTACGGTCTTCCCTTCTCTCGTACTCCTGAAGGCAAGATCTATC
AAAGAGCCTTCGGTGGTCAATCCCTCAAGTTCGGCAAGGGTGGTTAGGTATTAAATTAAA
TCATTAAACATTTAGAAGCACATTAGAGATAAAAGCATTGATACTTTTTAAGAGTACCAC
TTCATATCTATTAACCTAAAAAGTATAAGAAAAGCGAATTTCACAAACATTATGGAATAA
TTTGATACTACTAACAAAATTAAGTTTGGAGCATTTCAATATAAAAACATTTTAATTATT
AGATTCAATCTTTAAAAGGTTTCATTCATTCATTTATTCATACATATTTAATATGAAAAA
CGGGAATTTATTAAAAAGTTTACTATCTAAATAGAATATTAACAATAAAAACATAAAGAC
TAATAAAAGCTTGAAGCATCCAATTATCTACTCAGATTTTTAAGATTCATTTTAGAAAAT
TCGATAATTAAAAGACAGCCAAGTAAGAAAGCAAATAAATAAATAAACAAACAAACAAAT
CTTAAAAATGAATATTACAAAGCATCAAATATTTTTTAAAATGTGATTCAAAAAAGAAAG
CAAATGAAAAGGAAAGAATGAAAATTGACAAATCAAGAAAAGTGGAAATTAATTATATAA
TAAATCGAATTAGTAGATGAAAATTAAAACAGAATTTTCGTGAAGTGGTGTAAATTAGAA
ATTTCTACTTTACAAAAAATTAATTTGATGCTACTTTCTATTATATTTTATAAAATAATT
ACACAAATTAAAAATTATTAAACTTGATCAGTAATTAAAATATTACTTAAATAACTTGCT
TAGTCTAATCGTTCAATTATTGTTTTATTTGATATTATTTTTAACGATTTTTTATTAAAT
TAAGGCAAGAAGAACTGCTTGTGCAGCTGATAGAACTGGACATGCTATGTTACATACTTT
ATTCGGAAGATCCTTAGCTTATAATTGCAATTTCTTTATTGAATATTTCGTTATTGACTT
AATTATGGATGAAGAAGGTGCCTGCAGAGGTGTCATCTGTATGTCTATGGCTGATGGTTC
TATTCACAGAATCAGAGCCCATTACACTGTATTGGCTGCTGGTGGTTACGGTAGATCTTA
TCTTTCTTGCACTGCTGCTCACACCTGCACTGGTGATGGTATGGCTCTTGCTACTAGAGC
TGGACTTCCTCTTGAAGATCCTGAATTCGTTTAATTCCATCCTACTGGTAATTTGCATTA
TTTATGATTAATTAGTAGATTTCTTAATTAATTCTATAATTAAAAATTAGGTATCTACGG
TTCTGGTTGTTTGATGACCGAAGGTTGCAGAGGTGAAGGTGGTATCCTTGTTAACAGTAA
TGGTGAAGCTTTCATGGAAAAATATGCTCCCACTGCTAAGGATCTTGCTTCCAGAGATGT
CGTCTCTAGAGCTATGACTATTGAAATCCTTGAAGGTAGAGGTGTTGGCCCTAAGAAGGT
ACCTAATATAAATTGATTTATTTTTTTTATTTTATTGAAGAATCTTTTATTATTTTTAAA
AAGGATCACATTTTCTTATAATTACATCACTTGAGTCCTGAAACTTTACATTAGAGATTA
CCTGGTATTTCTGAAACTGCCAGAATTTTCGCAGGTGTTGATGTTACCAAAGAACCAGCT
CCTGTCGTTCCTACCGTTCACTACAATATGGGTGGTGTTCCCACTAACTGGAAGACTGAA
GTTATTACCCAAGACAAGAATGGAAAGGACAAGGTATTTAAATATATTTAAGTATGCATA
AACATAGATTAAAAATTTTCAATTATAATTAAAGATTGTTCCTGGTTTGCTTGCTGCTGG
TGAAAACGCTTGTGCTTCTGTCCACGGTGCTAACAGACTTGGTGCTAACTCTCTTTTAGA
TATTGTCGTTTTCGGTAGAGCTGCTGCCAAACTTGTTAAGGAAAAGCTTAAACCTGGTAC
TCCTCATAAGGATTTACCCAAGAATGCTGGTGAATAAGCTTTAGCCAGATTAGATAAATA
CAGATTTGCTAATGGTGAATACACTACTCACCACGTTAGAACTGCTATGTAAGAAACCAT
GTAACGTCACGCAGCTGTCTTCAGAATTGAAAAGCTTATGGCTGAAGGTGTTCAAAAATT
AGATCACATTTATGAATAATCAAAGAGCCTTAAAACCTTCGACAGAGGTCTTGTTTGGAA
CACTGATCTCATTGAAACCTTAGAATTAGAAAACCTTCTTTGTAAATAATTCATTTATTA
ATTTATATATAACTAATTAATTAATTAAAAATTAAAATCTTAGTATGCTCTAAATAAACT
CTTCTCGCTGGTTTACTCAGAAAGGAATCCAGAGGTGCTCACGCCAGAGACGATTTTAAG
GTAAATTTATAAGAAATTTATTTTTAATCCTGTAAATAAAATTAAATTGTAAAAATAGGA
AAGAGATGATAAGAATTGGATGAAGCACAGTCTCACTTGGATTAAAGATGTAAATACTGG
TAAAACTGAAGTAACCTATAGAGATGTCATCAACCACACTCTTGATAGTGAAGTTACTCC
TGTTCCTCCCGCTAAAAGATCATATTGA