Identifiers and Description

Gene Model Identifier

TTHERM_00047080

Standard Name

None

Aliases

PreTt11187 | 3.m01828 | 3824.m02946

Description

succinate dehydrogenase, flavoprotein subunit containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
PlasmoDBPF10_03349.99709313703352e-262Plasmodium falciparum 0334
Tetrahymena borealisEI9_01749.19.99709313703352e-262succinate dehydrogenase, f...
TAIRAT5G667609.99709313703352e-262succinate dehydrogenase (ubiqu
inone) flavoprotein subunit, m
itochondrial / flavoprotein su
bunit of complex II
DictyBaseDDB02060639.99709313703352e-262sdhA complex II, flavoprotein
subunit succinic dehydrogenase
succinate dehydrogenase (ubiq
uinone)
DictyBaseDDB02148869.99709313703352e-262sdhA complex II, flavoprotein
subunit succinic dehydrogenase
succinate dehydrogenase (ubiq
uinone)
FlyBaseFBgn00175399.99709313703352e-262
IPI(HUMAN)IPI:IPI00305166.19.99709313703352e-262 PROT:P31040|TREMBL:Q59GW8|ENS
EMBL:ENSP00000264932|REFSEQ :N
P_004159|H- INV:HIT000019734;H
IT000030364|VEGA:OTTHUMP000001
15308 Tax_Id=9606 Succinate de
hydrogenase [ubiquinone] flavo
protein subunit, mitochondrial
precursor
ParameciumDBGSPATP000086050019.99709313703352e-262Paramecium tetraurelia GSPATP0
0008605001 protein
ToxoDB33.m013809.99709313703352e-262Toxoplasma gondii succinate de
hydrogenase [ubiquinone] flavo
protein subunit, mitochondrial
, putative
WormBaseC03G5.19.99709313703352e-262WBGene00015391 succinate dehyd
rogenase flavoprotein subunit
SGDYKL148C9.99709313703352e-262SDH1 SGDID:S000001631, Chr XI
from 171134-169212, reverse co
mplement, Verified ORF, "Flavo
protein subunit of succinate d
ehydrogenase (Sdh1p, Sdh2p, Sd
h3p, Sdh4p), which couples the
oxidation of succinate to the
transfer of electrons to ubiq
uinone"
OxytrichaContig18065.0.g819.99709313703352e-262FAD binding domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047080(coding)
ATGTTTAAATACTTATCTAAGATATAAAGAGTTACCTTACACAGCAAAGTTTCAAAGAAT
TTTGCAGTTTTGTCAAAGGATCATCCCGAAAAGGGACCTTCCCAAGGTCATTTGACTGAC
AAATACACTGTCATTGATCACACCTATGATGCTATCGTTGTTGGTGCTGGTGGTGCTGGT
TTAAGAGCTGCTTTTGGTTTGGTTGAAGAAGGTTTCAAGACCGCTTGTATTACTAAGCTT
TTCCCTACTCGTTCTCACACAGTCGCTGCTTAAGGTGGTATTAACGCTGCTTTAGGTAAT
ATGACAGAAGATGACTGGAAATGGCATTTTTATGATACAGTTAAGGGTTCTGATTGGTTA
GGTGATTAAGATGCTATCTAATATATGACTAGAGAAGCTCCCGCTGCCGTCTTAGAATTA
GAATCTTACGGTCTTCCCTTCTCTCGTACTCCTGAAGGCAAGATCTATCAAAGAGCCTTC
GGTGGTCAATCCCTCAAGTTCGGCAAGGGTGGTTAGGCAAGAAGAACTGCTTGTGCAGCT
GATAGAACTGGACATGCTATGTTACATACTTTATTCGGAAGATCCTTAGCTTATAATTGC
AATTTCTTTATTGAATATTTCGTTATTGACTTAATTATGGATGAAGAAGGTGCCTGCAGA
GGTGTCATCTGTATGTCTATGGCTGATGGTTCTATTCACAGAATCAGAGCCCATTACACT
GTATTGGCTGCTGGTGGTTACGGTAGATCTTATCTTTCTTGCACTGCTGCTCACACCTGC
ACTGGTGATGGTATGGCTCTTGCTACTAGAGCTGGACTTCCTCTTGAAGATCCTGAATTC
GTTTAATTCCATCCTACTGGTATCTACGGTTCTGGTTGTTTGATGACCGAAGGTTGCAGA
GGTGAAGGTGGTATCCTTGTTAACAGTAATGGTGAAGCTTTCATGGAAAAATATGCTCCC
ACTGCTAAGGATCTTGCTTCCAGAGATGTCGTCTCTAGAGCTATGACTATTGAAATCCTT
GAAGGTAGAGGTGTTGGCCCTAAGAAGGATCACATTTTCTTATAATTACATCACTTGAGT
CCTGAAACTTTACATTAGAGATTACCTGGTATTTCTGAAACTGCCAGAATTTTCGCAGGT
GTTGATGTTACCAAAGAACCAGCTCCTGTCGTTCCTACCGTTCACTACAATATGGGTGGT
GTTCCCACTAACTGGAAGACTGAAGTTATTACCCAAGACAAGAATGGAAAGGACAAGATT
GTTCCTGGTTTGCTTGCTGCTGGTGAAAACGCTTGTGCTTCTGTCCACGGTGCTAACAGA
CTTGGTGCTAACTCTCTTTTAGATATTGTCGTTTTCGGTAGAGCTGCTGCCAAACTTGTT
AAGGAAAAGCTTAAACCTGGTACTCCTCATAAGGATTTACCCAAGAATGCTGGTGAATAA
GCTTTAGCCAGATTAGATAAATACAGATTTGCTAATGGTGAATACACTACTCACCACGTT
AGAACTGCTATGTAAGAAACCATGTAACGTCACGCAGCTGTCTTCAGAATTGAAAAGCTT
ATGGCTGAAGGTGTTCAAAAATTAGATCACATTTATGAATAATCAAAGAGCCTTAAAACC
TTCGACAGAGGTCTTGTTTGGAACACTGATCTCATTGAAACCTTAGAATTAGAAAACCTT
CTTTTATGCTCTAAATAAACTCTTCTCGCTGGTTTACTCAGAAAGGAATCCAGAGGTGCT
CACGCCAGAGACGATTTTAAGGAAAGAGATGATAAGAATTGGATGAAGCACAGTCTCACT
TGGATTAAAGATGTAAATACTGGTAAAACTGAAGTAACCTATAGAGATGTCATCAACCAC
ACTCTTGATAGTGAAGTTACTCCTGTTCCTCCCGCTAAAAGATCATATTGA


>TTHERM_00047080(protein)
MFKYLSKIQRVTLHSKVSKNFAVLSKDHPEKGPSQGHLTDKYTVIDHTYDAIVVGAGGAG
LRAAFGLVEEGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHFYDTVKGSDWL
GDQDAIQYMTREAPAAVLELESYGLPFSRTPEGKIYQRAFGGQSLKFGKGGQARRTACAA
DRTGHAMLHTLFGRSLAYNCNFFIEYFVIDLIMDEEGACRGVICMSMADGSIHRIRAHYT
VLAAGGYGRSYLSCTAAHTCTGDGMALATRAGLPLEDPEFVQFHPTGIYGSGCLMTEGCR
GEGGILVNSNGEAFMEKYAPTAKDLASRDVVSRAMTIEILEGRGVGPKKDHIFLQLHHLS
PETLHQRLPGISETARIFAGVDVTKEPAPVVPTVHYNMGGVPTNWKTEVITQDKNGKDKI
VPGLLAAGENACASVHGANRLGANSLLDIVVFGRAAAKLVKEKLKPGTPHKDLPKNAGEQ
ALARLDKYRFANGEYTTHHVRTAMQETMQRHAAVFRIEKLMAEGVQKLDHIYEQSKSLKT
FDRGLVWNTDLIETLELENLLLCSKQTLLAGLLRKESRGAHARDDFKERDDKNWMKHSLT
WIKDVNTGKTEVTYRDVINHTLDSEVTPVPPAKRSY


>TTHERM_00047080(gene)
ATAATTAATATCTAAAAACAAGACTAGGGAGAAAAAGGAAATTTTTAGAAAGAAAAATGT
TTAAATACTTATCTAAGATATAAAGAGTTACCTTACACAGCAAAGTTTCAAAGAATTTTG
CAGTTTTGTCAAAGGATCATCCCGAAAAGGGACCTTCCCAAGTATGCAAATATTCTATCT
ATTCATTTTTGATTGAAGGAATTGAATGCAAGTGAAGAAGGAGAGATATTAGTTAATAAA
TGAAACTTTAAAATGAAAATGGTTGGTTTCAGCGCTATTCACGTTACTAATTACTTGCAA
AAGAATAATAATTTATTCAAATAAATTTTGCTCAATATAAAATAGTTGAGTAATGGAGCA
TCATACCATTTTTTACAATTTAGCAAATGCTTGCTTATTATCCCTAATATATCAATCAAT
TATATAAGCCTTAAACAACTCTCGCTACTTCTTTTGCTTTCTCTTCTAAGGATCCCATTC
ATTTTTTGTTTTAATTTAATTTTTTTGATCTAAAATCGTTTTTATTTTTAAGGGTCATTT
GACTGACAAATACACTGTCATTGATCACACCTATGATGCTATCGTTGTTGGTGCTGGTGG
TGCTGGTTTAAGAGCTGCTTTTGGTTTGGTTGAAGAAGGTTTCAAGACCGCTTGTATTAC
TAAGCTTTTCCCTACTCGTTCTCACACAGTCGCTGCTTAAGGTGGTATTAACGCTGCTTT
AGGTAATATGACAGAAGATGACTGGAAATGGCATTTTTATGATACAGTTAAGGGTTCTGA
TTGGTTAGGTGATTAAGATGCTATCTAATATATGACTAGAGAAGCTCCCGCTGCCGTCTT
AGAATTAGAATCTTACGGTCTTCCCTTCTCTCGTACTCCTGAAGGCAAGATCTATCAAAG
AGCCTTCGGTGGTCAATCCCTCAAGTTCGGCAAGGGTGGTTAGGTATTAAATTAAATCAT
TAAACATTTAGAAGCACATTAGAGATAAAAGCATTGATACTTTTTAAGAGTACCACTTCA
TATCTATTAACCTAAAAAGTATAAGAAAAGCGAATTTCACAAACATTATGGAATAATTTG
ATACTACTAACAAAATTAAGTTTGGAGCATTTCAATATAAAAACATTTTAATTATTAGAT
TCAATCTTTAAAAGGTTTCATTCATTCATTTATTCATACATATTTAATATGAAAAACGGG
AATTTATTAAAAAGTTTACTATCTAAATAGAATATTAACAATAAAAACATAAAGACTAAT
AAAAGCTTGAAGCATCCAATTATCTACTCAGATTTTTAAGATTCATTTTAGAAAATTCGA
TAATTAAAAGACAGCCAAGTAAGAAAGCAAATAAATAAATAAACAAACAAACAAATCTTA
AAAATGAATATTACAAAGCATCAAATATTTTTTAAAATGTGATTCAAAAAAGAAAGCAAA
TGAAAAGGAAAGAATGAAAATTGACAAATCAAGAAAAGTGGAAATTAATTATATAATAAA
TCGAATTAGTAGATGAAAATTAAAACAGAATTTTCGTGAAGTGGTGTAAATTAGAAATTT
CTACTTTACAAAAAATTAATTTGATGCTACTTTCTATTATATTTTATAAAATAATTACAC
AAATTAAAAATTATTAAACTTGATCAGTAATTAAAATATTACTTAAATAACTTGCTTAGT
CTAATCGTTCAATTATTGTTTTATTTGATATTATTTTTAACGATTTTTTATTAAATTAAG
GCAAGAAGAACTGCTTGTGCAGCTGATAGAACTGGACATGCTATGTTACATACTTTATTC
GGAAGATCCTTAGCTTATAATTGCAATTTCTTTATTGAATATTTCGTTATTGACTTAATT
ATGGATGAAGAAGGTGCCTGCAGAGGTGTCATCTGTATGTCTATGGCTGATGGTTCTATT
CACAGAATCAGAGCCCATTACACTGTATTGGCTGCTGGTGGTTACGGTAGATCTTATCTT
TCTTGCACTGCTGCTCACACCTGCACTGGTGATGGTATGGCTCTTGCTACTAGAGCTGGA
CTTCCTCTTGAAGATCCTGAATTCGTTTAATTCCATCCTACTGGTAATTTGCATTATTTA
TGATTAATTAGTAGATTTCTTAATTAATTCTATAATTAAAAATTAGGTATCTACGGTTCT
GGTTGTTTGATGACCGAAGGTTGCAGAGGTGAAGGTGGTATCCTTGTTAACAGTAATGGT
GAAGCTTTCATGGAAAAATATGCTCCCACTGCTAAGGATCTTGCTTCCAGAGATGTCGTC
TCTAGAGCTATGACTATTGAAATCCTTGAAGGTAGAGGTGTTGGCCCTAAGAAGGTACCT
AATATAAATTGATTTATTTTTTTTATTTTATTGAAGAATCTTTTATTATTTTTAAAAAGG
ATCACATTTTCTTATAATTACATCACTTGAGTCCTGAAACTTTACATTAGAGATTACCTG
GTATTTCTGAAACTGCCAGAATTTTCGCAGGTGTTGATGTTACCAAAGAACCAGCTCCTG
TCGTTCCTACCGTTCACTACAATATGGGTGGTGTTCCCACTAACTGGAAGACTGAAGTTA
TTACCCAAGACAAGAATGGAAAGGACAAGGTATTTAAATATATTTAAGTATGCATAAACA
TAGATTAAAAATTTTCAATTATAATTAAAGATTGTTCCTGGTTTGCTTGCTGCTGGTGAA
AACGCTTGTGCTTCTGTCCACGGTGCTAACAGACTTGGTGCTAACTCTCTTTTAGATATT
GTCGTTTTCGGTAGAGCTGCTGCCAAACTTGTTAAGGAAAAGCTTAAACCTGGTACTCCT
CATAAGGATTTACCCAAGAATGCTGGTGAATAAGCTTTAGCCAGATTAGATAAATACAGA
TTTGCTAATGGTGAATACACTACTCACCACGTTAGAACTGCTATGTAAGAAACCATGTAA
CGTCACGCAGCTGTCTTCAGAATTGAAAAGCTTATGGCTGAAGGTGTTCAAAAATTAGAT
CACATTTATGAATAATCAAAGAGCCTTAAAACCTTCGACAGAGGTCTTGTTTGGAACACT
GATCTCATTGAAACCTTAGAATTAGAAAACCTTCTTTGTAAATAATTCATTTATTAATTT
ATATATAACTAATTAATTAATTAAAAATTAAAATCTTAGTATGCTCTAAATAAACTCTTC
TCGCTGGTTTACTCAGAAAGGAATCCAGAGGTGCTCACGCCAGAGACGATTTTAAGGTAA
ATTTATAAGAAATTTATTTTTAATCCTGTAAATAAAATTAAATTGTAAAAATAGGAAAGA
GATGATAAGAATTGGATGAAGCACAGTCTCACTTGGATTAAAGATGTAAATACTGGTAAA
ACTGAAGTAACCTATAGAGATGTCATCAACCACACTCTTGATAGTGAAGTTACTCCTGTT
CCTCCCGCTAAAAGATCATATTGAGGAAATTTAGATAATAATCAAAAATAAATTAACTTC
ACTCATTAAAATAAAATTAATGATAAATAATTAACTAAAGAAGTAAACAATATAACTATT
CTTAATTTGATTTCAATGAGGGATAGTTA