Identifiers and Description

Gene Model Identifier

TTHERM_00046330

Standard Name

None

Aliases

PreTt11112 | 3.m01952 | 3824.m02873

Description

plant dual-specificity MAP kinase kinase family domain protein; Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_00046330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01818.19.997093137033517e-262protein kinase domain-containi
ng protein (809 aa)
OxytrichaContig16615.0.g11.9999788875029746e-125Protein kinase domain
DictyBaseDDB_G02752412.0006398763136557e-76nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000214616.9972728945133496e-59locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
Stentor CoeruleusSteCoe_355241.2806276389220833e-57
SGDYJL164C3.9990760533890984e-36TPK1 cAMP-dependent protein ki
nase catalytic subunit; promot
es vegetative growth in respon
se to nutrients via the Ras-cA
MP signaling pathway; inhibite
d by regulatory subunit Bcy1p
in the absence of cAMP; partia
lly redundant with Tpk2p and T
pk3p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046330(coding)
ATGGATAACTATATTAAGATAGAACTTGTAGGGAAAGGAAATTTTGGATTGGCAGTATTA
GTTTAGTCCAAAATCAATCGAAAATATTATATAATGAAGATTATAGATATTTTGCGTTTA
GATTAAAGATAAAGATAAGATGCATTAAATGAAGTTAAATTTTTAAAAGAACTAGGACAT
CCTTTCATCATAGCTTATCGTGAGTCTTTTGTCGATAAAGATCGATATTTGTGTATAGTT
ATGGATTATTGTGAAGAAGGAGATCTTTACAATTAAATTATTGAATAAAAGAAAACAGGA
TAAGGATTTACAGAATAATAAATTCTGGAATGGTTTGTTTAAATTTGTTTTGGTTTGAAA
TTTATTCACGATAGGAGAATATTACATAGGGATCTTAAAACCCAAAACATTTTTTTAACT
AAATCAAAGTAAATCAAAATAGGAGACTTTGGTATTGCTAAAGTACTTTAAAATACTTGT
GAAATGGCTAAGACAGCCATAGGAACGCCTTACTATTTATCTCCTGAAATATGTTAATAA
AAGCCCTATAATCAAAAAACTGATATATGGAGTCTTGGGTGCATTTTATATGAATTATGT
ACACTAAGACATGCTTTTGATGCAAAACATTAATAGGGGTTGGTTCTTAAAATCTTAAAG
GGAAACTATCCTTCTATTCCAAATTGCTACTCACCCTAATTAAGCGATTTAATAGGCGAA
ATGCTTTAAAGACATCCTGCAAAAAGGCCTTCTGTTAAAAAAATTTTAGAAAAATAGTTT
TTAGCTAACACAATAAATAAAATTTTGGCAAATATGGTGTAATAATCAAGTAACCGCAAA
GGAACAAGCTCTTAAAATGATGTTTAAGTAATATAATAATTAGCAGAAGGGATTCAGTCA
AATAATATAGAAAGACAAATCACAAAAAATGATGAAAACCAAGCTCCTTTAGCAAAATAA
TAGTAAGAGCAATAAAAGTCAAACATATAAAATAGTAATTAGCAGCCACAAAGCTTAAAT
TCTTCTTTTTTAAGGCAATTATATTAACACCAGAATTAAATATAAAATCCATAGTAATAA
TAGTAAATAGCATCTAATTGCGATAGTATTATTTAACAACAGAAACTCTAATATTTACAA
AATTAGCAAGAATATAAAGAAAAGTAAGGAGTTTAAAACTAAATCTCTTACTCTTAAAGC
GCTATTAAATAAAATGGAGAAGAGTTTAGAACTCCAATTTAAGAAAAAAAAATAAATAAT
CTTTATGGTTCATCATCTTCTGACTAATAATAATCCACTACTTTAGCAGAAATAAAAAGC
TAATTTCCTTCATTTTAGATGAATGGAGGTGTTGGATAACAGTAAGCAAATTAAATTTCC
CTAAATCTAGGCAACTAATAGATTTAGATGAAAAATAACATTTAAGGTAATTAAGCAAAT
ATAAATAACATCTAATTGATAAATAAAAATGAAAATTAAATTCTATAAAATAATGGTGTA
AGATAATCTTCTCTAACTAGATAAGACAATATAAATCCTTATTAAAACTATAAAAATATT
TAAAGTATATAAAATCCCTTGAGAAGATCTTTCGATGGATCTTAAGACAATAGTATTTAT
TAAAATTAAAAAAGTACCTCGCCTTTATTATAAAATCAAAATAACTCAAATAATAAGATA
GTAAGTCCTTTGTATCACAAAAGCTCAAACAAAATAATTAACCCTTAGTAAAATAATGTA
TATACTAGTATTCCTCCTTTAGCTAATTAAAATCAAGCAGTCAGAAGCAGTATAGAGCAC
TTAAGCAATCCATTACTACCATCTTTATCCTCTTCTTCTATTTCTTCAAGTAGAAAACAG
CAAGGAAATTCAGGCAGTTTAGCAAATATACCTCTTCCTAATTAAAATCATTAAAAAAAT
TCTTTATCCCAAATACCTAATTTTTCCCTACCTCAAATATAATAATAATAAAGCGATTAA
TAAATACAAAAATAACGATCAAACTCTATAAACTCTATCTTAAGCAATCAAAAAAAGTAA
TTCAATAATACCTAATAATCTGACTCTGATGAAGATTTTGAAGAGCCTGAAGATTAGAGA
GTTAAATGCGAATTTTTGGGTGTAGATGGTATTCAAATTCCAGGTATGAGTGAGAAAGAC
TCAATATTTAACAGAATAGAAGCATTAAAAGTTTATTTAGAAAGAAATCTAGGCGAAGAT
TTATTTATTTAAATTTACTAAGAAATTCAGCTGTAAGATTAAAACTTGAGTGAAACAGAT
TAAACCAAACGTATAAATAGTATTCTTAATGTAGACTAATAAAAATTTATTCCTCTTATA
TATTAAATGATATTTTGTGAAGATTCCTACTATACTAACTCATGA


>TTHERM_00046330(protein)
MDNYIKIELVGKGNFGLAVLVQSKINRKYYIMKIIDILRLDQRQRQDALNEVKFLKELGH
PFIIAYRESFVDKDRYLCIVMDYCEEGDLYNQIIEQKKTGQGFTEQQILEWFVQICFGLK
FIHDRRILHRDLKTQNIFLTKSKQIKIGDFGIAKVLQNTCEMAKTAIGTPYYLSPEICQQ
KPYNQKTDIWSLGCILYELCTLRHAFDAKHQQGLVLKILKGNYPSIPNCYSPQLSDLIGE
MLQRHPAKRPSVKKILEKQFLANTINKILANMVQQSSNRKGTSSQNDVQVIQQLAEGIQS
NNIERQITKNDENQAPLAKQQQEQQKSNIQNSNQQPQSLNSSFLRQLYQHQNQIQNPQQQ
QQIASNCDSIIQQQKLQYLQNQQEYKEKQGVQNQISYSQSAIKQNGEEFRTPIQEKKINN
LYGSSSSDQQQSTTLAEIKSQFPSFQMNGGVGQQQANQISLNLGNQQIQMKNNIQGNQAN
INNIQLINKNENQILQNNGVRQSSLTRQDNINPYQNYKNIQSIQNPLRRSFDGSQDNSIY
QNQKSTSPLLQNQNNSNNKIVSPLYHKSSNKIINPQQNNVYTSIPPLANQNQAVRSSIEH
LSNPLLPSLSSSSISSSRKQQGNSGSLANIPLPNQNHQKNSLSQIPNFSLPQIQQQQSDQ
QIQKQRSNSINSILSNQKKQFNNTQQSDSDEDFEEPEDQRVKCEFLGVDGIQIPGMSEKD
SIFNRIEALKVYLERNLGEDLFIQIYQEIQLQDQNLSETDQTKRINSILNVDQQKFIPLI
YQMIFCEDSYYTNS


>TTHERM_00046330(gene)
ATGGATAACTATATTAAGATAGAACTTGTAGGGAAAGGAAATTTTGGATTGGCAGTATTA
GTTTAGTCCAAAATCAATCGAAAATATTATATAATGAAGGTATACATTTTTTAATAAACG
ATAATAGAGTTTTTGAAATTTTAGTAGGATTTACTATGAAACAAAATAAATACAATTAAT
CAAGAAAAAAAAGAACTTATTTGTCTTTCAAAAATGTTTAAGATTGTTTTTTAATTACTA
ATAGATTATAGATATTTTGCGTTTAGATTAAAGATAAAGATAAGATGCATTAAATGAAGT
TAAATTTTTAAAAGAACTAGGACATCCTTTCATCATAGCTTATCGTGAGTCTTTTGTCGA
TAAAGAGTAAAGATTTAAAATATTTTACAAAAACAGAAAGCATGTTTCATTAAAAAAATA
ATAAAATATTGGAATTTCAATAAATATTTTGAAAATCCTAAACATTTATCAATCTTTAAA
TTCAAATATAATATTAATATATTTTTTTATATATAAAAAGTCGATATTTGTGTATAGTTA
TGGATTATTGTGAAGAAGGAGATCTTTACAATTAAATTATTGAATAAAAGAAAACAGGAT
AAGGATTTACAGAATAATAAATTCTGGAATGGTTTGTTTAAATTTGTTTTGGTTTGAAAT
TTATTCACGATAGGAGAATATTACATAGGGATCTTAAAACCCAAAACATTTTTTTAACTA
AATCAAAGTAAATCAAAATAGGAGACTTTGGTATTGGTAAATATTAATATAATTGCAAGT
AGGATATATAAATATAATAAAATTTTAATATACAGCTAAAGTACTTTAAAATACTTGTGA
AATGGCTAAGACAGCCATAGGAACGCCTTACTATTTATCTCCTGAAATATGTTAAGTATA
TTTTTAAATCTTGTTTATTATCTGCTTTGTTTAAAAAACAGATTCATAATAAATATATTA
CAAAATAATAACAGTAAAAGCCCTATAATCAAAAAACTGATATATGGAGTCTTGGGTGCA
TTTTATATGAATTATGTACACTAAGACATGCTTTTGATGCAAAACGTAAGTTTTAATGTA
AATATTGAAATTTACATTTATCACTTTTAAAGATTAATAGGGGTTGGTTCTTAAAATCTT
AAAGGGAAACTATCCTTCTATTCCAAATTGCTACTCACCCTAATTAAGCGATTTAATAGG
CGAAATGCTTTAAAGACATCCTGCAAAAAGGCCTTCTGTTAAAAAAATTTTAGAAAAATA
GTTTTTAGCTAACACAATAAATAAAATTTTGGCAAATATGGTGTAATAATCAAGTAACCG
CAAAGGAACAAGCTCTTAAAATGATGTTTAAGTAATATAATAATTAGCAGAAGGGATTCA
GTCAAATAATATAGAAAGACAAATCACAAAAAATGATGAAAACCAAGCTCCTTTAGCAAA
ATAATAGTAAGAGCAATAAAAGTCAAACATATAAAATAGTAATTAGCAGCCACAAAGCTT
AAATTCTTCTTTTTTAAGGCAATTATATTAACACCAGAATTAAATATAAAATCCATAGTA
ATAATAGTAAATAGCATCTAATTGCGATAGTATTATTTAACAACAGAAACTCTAATATTT
ACAAAATTAGCAAGAATATAAAGAAAAGTAAGGAGTTTAAAACTAAATCTCTTACTCTTA
AAGCGCTATTAAATAAAATGGAGAAGAGTTTAGAACTCCAATTTAAGAAAAAAAAATAAA
TAATCTTTATGGTTCATCATCTTCTGACTAATAATAATCCACTACTTTAGCAGAAATAAA
AAGCTAATTTCCTTCATTTTAGATGAATGGAGGTGTTGGATAACAGTAAGCAAATTAAAT
TTCCCTAAATCTAGGCAACTAATAGATTTAGATGAAAAATAACATTTAAGGTAATTAAGC
AAATATAAATAACATCTAATTGATAAATAAAAATGAAAATTAAATTCTATAAAATAATGG
TGTAAGATAATCTTCTCTAACTAGATAAGACAATATAAATCCTTATTAAAACTATAAAAA
TATTTAAAGTATATAAAATCCCTTGAGAAGATCTTTCGATGGATCTTAAGACAATAGTAT
TTATTAAAATTAAAAAAGTACCTCGCCTTTATTATAAAATCAAAATAACTCAAATAATAA
GATAGTAAGTCCTTTGTATCACAAAAGCTCAAACAAAATAATTAACCCTTAGTAAAATAA
TGTATATACTAGTATTCCTCCTTTAGCTAATTAAAATCAAGCAGTCAGAAGCAGTATAGA
GCACTTAAGCAATCCATTACTACCATCTTTATCCTCTTCTTCTATTTCTTCAAGTAGAAA
ACAGCAAGGAAATTCAGGCAGTTTAGCAAATATACCTCTTCCTAATTAAAATCATTAAAA
AAATTCTTTATCCCAAATACCTAATTTTTCCCTACCTCAAATATAATAATAATGTAATTT
TATTTAATTTTATATAATACATTTATTTATTTAACTAAATACAAAATAGAAAGCGATTAA
TAAATACAAAAATAACGATCAAACTCTATAAACTCTATCTTAAGCAATCAAAAAAAGTAA
TTCAATAATACCTAATAATCTGACTCTGATGAAGATTTTGAAGAGCCTGAAGATTAGAGA
GTTAAATGCGAGTAAAAATTTTAAATTTTAAATACATAAATGAATTCTCATTGTTAATAA
TATAAGATTTTTGGGTGTAGATGGTATTCAAATTCCAGGTATGAGTGAGAAAGACTCAAT
ATTTAACAGAATAGAAGCATTAAAAGTTTATTTAGAAAGAAATCTAGGCGAAGATTTATT
TATTTAAATTTACTAAGAAATTCAGGTAAAACAAACAAACAAACAAAAAACAATAAATTA
ATATACAAATAAAATATATTCATTTCATCTTATTTTAAAATATTTAAATTTATAAAAAAA
GCTGTAAGATTAAAACTTGAGTGAAACAGATTAAACCAAACGTATAAATAGTATTCTTAA
TGTAGACTAATAAAAATTTATTCCTCTTATATATTAAATGATATTTTGTGAAGATTCCTA
CTATACTAACTCATGA