Identifiers and Description

Gene Model Identifier

TTHERM_00037530

Standard Name

None

Aliases

PreTt14487 | 2.m02264 | 3825.m02856

Description

Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to the CAMKL protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00037530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01006.19.997093137033517e-262protein kinase domain-containi
ng protein (1615 aa)
OxytrichaContig647.1.g92.0000857274312427e-108Protein kinase domain
WormBaseWBGene000201428.003951791518226e-58locus:aak-2 5-AMP-activated
protein kinase catalytic subun
it alpha-2 status:Confirmed
UniProt:Q95ZQ4 protein_id:
CCD68833.1
DictyBaseDDB_G02779053.000458792073453e-56snfA on chromosome: 3 position
589784 to 592434
SGDYDR477W2.9994376937714457e-52SNF1 AMP-activated serine/thre
onine protein kinase found in
a complex containing Snf4p and
members of the Sip1p/Sip2p/Ga
l83p family; required for tran
scription of glucose-repressed
genes, thermotolerance, sporu
lation, and peroxisome biogene
sis
Stentor CoeruleusSteCoe_266171.2479464629129513e-47

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00037530(coding)
ATGGACGCATATTCTGGATGCAGCAGCACTAAATAGTAATACAAGAATATTCGCATGGAG
GATATCTAAGCTATGATGAATAAGGGGTACTCTTCAACTAAGAATAATAATTCATCAGCG
TCTTTGGCAGAAAGAATACGCAAAATGTATAGAAACTAAGTTGGAAATACACCCTCAAGC
AGTTAGGGAAATGGAAATGGTTTAAATTAAGGGATATAAATAGGAGGGAATGTCTAATTA
TAGTAAAATGCAAATAATCTAAGCAGCAATAACATGAATAATGCAGGTTCTAAGGGCAAC
TTGAAGGACTTGCTTGATAATTTTTACAAAAGAAATTCAAAATCTCCTTAATAAAGCAAT
AGCAATACAGCTACAAACACAAGCATTTTATCATAAAATACTAACATAGCTAATGGATCT
ATGGGTATAATTAACCAATAATACTCTAACTAAAATAATGTAAACAAAATGATTGAAAGA
ACTGGAGCTAAGGCTTCCGAAGGACTGAAAAATTATGTCACAAATATTATTATGAAGAAG
ATGAGTAAAGAGGATTTAAAAAACAATTAAGAAAATATACAGTCTTACGCCTAAGCTTCT
ACAAACAACAGCACTTCTTAAAACTCTTTTTACAAGAAAAAGAGTCACTCAATAAGCAAC
AAATACTAAACTGGTTAGATTATTAATTCTTCCATATCAAATTAACCTACAGGTCTTTCA
ACTCAGCCATCAGCACAGAGGTACGCCTATTCAAATTAAAGACCTTCTCAAAAATTGAAT
GAAACTGACTTAAATCTTCTAAATAAAACTATTGGAAATAATAATTTGAATAACATAAGC
GGACAGTAATCTTACTCTCCTTGCACAAAAGCTGCATTGTAATATCATTAGTAATAAATG
CAATATGCTAAAGAACCATTATAGCCTCACTATGCTCCTCATTCAAACTAACAGCAATAA
CTACTACTTCAATCATAGGCTAAATCTAATTAAATTAAAGACGTTAGAGGAATTGATATT
TTAAAAAGCCCAACAAATTAGTAATAATCAGTTTAAAAGAAGAGACCAAAAACTATAGCT
AATAAGGAAAATGCTTATGGAAATAATGAAAATGTAAATTACACCTAATTAAATAACTCG
TCAAATGTGTTTACTTCTTCTACTTAACAATAATTTAACATGTTAAATTCCTCATCAAAT
TAAGTAAATACTCCAACGAATAACAATATCAATTTAAACAGCTACAACAATAACGGTTAA
AGCAATAACAAATATAGAGAAATAAGTATAAGACTTAATAATTCAAGTGAGTTTTTGAAA
AACTATTAAAAGATTACAAGGGAAAAAAGCTCAGAAACCTGCACCAATTAATCTAAAGAG
ATTATTTCTTTCAATCAATAGTAAATTTAACCTTAGAATTCTAAACGTGCTCTCTCAACA
GGATTAAAACCAAATACTATCATTCTAAATTAAAATTGTATTTAAACTAGTTAGAATTAT
AATCCAAATGGTGTAATGCTAAATAATTAAGGGAATAGCAATATCAGTCATTCTTACTTA
AACACAACCCATTTAAATAATAACAACAGCGGAAGTGGAAGTAACTTGCTACTTAACAAC
ATAAATACAAACAGCAATAACAATATCATAAATTAAAATACATAGGCTTCTCCCTTGAAC
AGTAGTCATCATAAAAATAATAGCTCGTTAAATTATTACAAGCAACAAATTTAGTAAACT
AGCAAACCTATGCTGGTTTAACAATAATAATAGGTTGTTTAATAACAATAATAATAATAG
TAATAATAGCAATTACAAATTCAGTAACAATAACAGCTTTAATAACAATTTTAAACTAAC
TCATCAAATAACTAGCAGTTGTAACAAATAAAAATACAATCAACCAAAGAAAATAAAAAA
ATTGAATTTCCATCATATTTGGGATAGTAAATTTTGACTTGTGATAATAAGAGAAAGTAA
AATGAACATTTTTAGTTTGACTTCCCAAGCACAACAACAAATGCTACAGCAGTAAAATTG
AATTAAAATACTTAATCTTCATTACAGTCAAATACAATTTAAAATGCTACTATTTTGCAA
ACATAGCAAAATAACTAAAGTAATTCTGGAGTTAAAAATTATGATGCTTAATAGATTACG
ACAACTGTTACAAATACTTAAGTTTATGATTGTGAAGAAAATACCACTACTGCTAAAAAA
TAAAAACCTACTAGCACTGAGCCAAATGGAGTTTCTGCAGCAGCTTAATACCCTTTGTCA
GGAATATAACAAGTAAATTAAAACATCGCTGCACCTTAAAATGCTCCTTACAATCCATTC
TCTAGCAACGGTACTCCAAAAGATCACGCTGACAATATTAGATTCTTAAATGATGATTCT
AAGTGCTACGAGCCCGATAAGTTCTTATCTGCTCTTCCTGAAGAGAAGGAACGAAAAATT
ATTCAATTTTAAGATGATAACATAGACAAGACACAAAAATTCAAGGAAGAATATCTTGTT
GGTAAACAAGTAGGGCAAGGCGCTTATGCCACTGTAAGAGTTGCCTTAAATAAAATATTC
AACAAAAAAGTAGCTATAAAGATTTATGAAAAGCAAAGAATAAAAGAACCCCAAAGAAAG
AAATCAGTTAGAAGAGAAATAAAACTTTTACAAATGCTAAACCATTAGAACGTTATCAAA
GTTTACGACACAATAGAAACTAATAACCATGTAAATATCATTATGGAATATATTCCTGGT
ACTTCTCTCCATGGATACTTAAAGGCTTAGCCCAATAGAAGACTCACTGAAAATGATGCC
AAAAGGATATTTAAACAACTTGTTTCGTCTATTGAGTATATTCACTCAAAATAAATTTGC
CACAGAGATATCAAATTAGAAAATATTCTCCTTGATGAAAATAATAATCCTAAATTAATT
GACTTTGGATTTTCTACTTGCATCCCAAATGATTAAAAATATAAAATGTTTTGTGGTACC
CCTTCATATATGGCACCTGAAATTGTTAATAAAAGAGAATATACTGGTCCACCTGCTGAT
ATTTGGGCTCTTGGTGTCCTTCTATATGCATTACTATGTGGCACATTCCCTTTTAAAGGA
TAAACCGATAAGGAACTCTATAAGAAAATAACCAAAGGTGATTTCCTTTCTCCTGATTTC
CTTTCAAAGGAAGCTAGAGATTTTATCAAATGGGTATTAAATACAGATTGTGACTTAAGA
CCAACTGCAACAGAAGTTTTAAGTCATCCTTGGTTGGGAGGAAAGAAGAATACCTTTATG
TAAAATTAAAATCCTTCTTCTCATTAGCAATCTTCTATTTCTTCAAATCCTCAATCATCA
TAAAACTAGTAAATATCTATAAGCGGAAATCAGCAATCAAATAACTTTGATAATAATCTC
TAATAATTACAATAGTAATAATAATAATAATAACAATAGTAATAGTAAATTTAACAACAG
CAATAGCAACTGGTGTTAAATGGTGGTAATTGCAATTCTAACACGAATTCAAGCAGTACT
ATCTTAGTAAATAACTATCTATAATTAAATAGTCCTTTCAATTCTAATCTGAAACAATTC
AAATTCAATAACCCTCAAAAGACACCTTCTTCAGCATCAGGAATACATATGCAACTTGGT
AATCTTGGCAACATCAGCACCCCAAGTAACATGGGACAACAAATTAATTTTACAAATAAT
TAAGAAAATAACTTCCCTCAAAAATCTAATGAAAAAGACAAATTTATGTCTCCAAATAAT
TTATTTTATTACCCTAATAAGCCTAATGCTACAAATGTAATGACTCCTTCTTAGCAAAAT
AATAACAATATTAATAATAATACTAATTAGAATAATAGCAATTACTTTATTAATAATAAA
AATATAGTAATTTAGTTAAATAATAATGATGGAAACAGTCCAACATCTAAGCCCCCTCTT
CCTTTAACAACTAAGAGTTCTTCGTGCAATTATTAAAATTATTTTATTAGCAACAACAAT
CCTTCTAGTAATAATATTAATAATAATAATAATAATGGAAACAATACATTCTCTGATAGT
CCTATGAACTATAATTCAACCTATCACAACTTATAGAAAAGACACGAAAAGCGCATGGAA
CTATTTAGAAATTCTTAGGATTATGTTTAATAGCCTAATTCAGGAGACTGCACTTATATT
TCTGATAAAAATAATTAATCAAGTAATAACATGAACATTAATCCTTATAATCATCCTGTA
CACCACCTTAATACCTAAGGAAGTAGTAACAACATAAACACAACTGGAAATGGCCATAGT
ACATAAAACTTTGCCTTACATCATCTGAATGATGATGAGCCTATCAATAGCATTGATTCA
GATGTCTTAAAAAGCATTGTTTATATGGGATATACTAATGATGAAGAAACACTAGTTAAT
GGTATAAGAGATCCTAAGAATCCACTTTTTAATCTCTATAAGAAGATTTATAATAAGAAA
GTTCATTAAAATAAGACTATTTATCCCAGCCATATGCCAGGAACATCATTTATAAGCTCT
TTAGGGTCTGTAAAGTCTCCTCAATCTTCTTCTGTTAACAACAATGTATCTTGCAACAGA
GGCGGATATAAGAAGGTTATAAATTTTGGTAATAGTTACAATCAAGAGCAAAATACTTTC
AATTAAAGTTTTAATAACAACGTTAACCCTCTTTCTACTAAAAATATAATGGGAGGTATC
ATTCCTAGCTCAACAACAAACAGCAATAACAATAATACTAACATTCTTAATAGTGGCTCA
TTTTTAAATACAACATCTAATAATATTTTAAACAATACAACAATTAATAAATTTTATGAG
CAAGAAGTAGTTATTGGATAAAATATTTAATAATAATAACAATAATAACAATTCTATTGA


>TTHERM_00037530(protein)
MDAYSGCSSTKQQYKNIRMEDIQAMMNKGYSSTKNNNSSASLAERIRKMYRNQVGNTPSS
SQGNGNGLNQGIQIGGNVQLQQNANNLSSNNMNNAGSKGNLKDLLDNFYKRNSKSPQQSN
SNTATNTSILSQNTNIANGSMGIINQQYSNQNNVNKMIERTGAKASEGLKNYVTNIIMKK
MSKEDLKNNQENIQSYAQASTNNSTSQNSFYKKKSHSISNKYQTGQIINSSISNQPTGLS
TQPSAQRYAYSNQRPSQKLNETDLNLLNKTIGNNNLNNISGQQSYSPCTKAALQYHQQQM
QYAKEPLQPHYAPHSNQQQQLLLQSQAKSNQIKDVRGIDILKSPTNQQQSVQKKRPKTIA
NKENAYGNNENVNYTQLNNSSNVFTSSTQQQFNMLNSSSNQVNTPTNNNINLNSYNNNGQ
SNNKYREISIRLNNSSEFLKNYQKITREKSSETCTNQSKEIISFNQQQIQPQNSKRALST
GLKPNTIILNQNCIQTSQNYNPNGVMLNNQGNSNISHSYLNTTHLNNNNSGSGSNLLLNN
INTNSNNNIINQNTQASPLNSSHHKNNSSLNYYKQQIQQTSKPMLVQQQQQVVQQQQQQQ
QQQQLQIQQQQQLQQQFQTNSSNNQQLQQIKIQSTKENKKIEFPSYLGQQILTCDNKRKQ
NEHFQFDFPSTTTNATAVKLNQNTQSSLQSNTIQNATILQTQQNNQSNSGVKNYDAQQIT
TTVTNTQVYDCEENTTTAKKQKPTSTEPNGVSAAAQYPLSGIQQVNQNIAAPQNAPYNPF
SSNGTPKDHADNIRFLNDDSKCYEPDKFLSALPEEKERKIIQFQDDNIDKTQKFKEEYLV
GKQVGQGAYATVRVALNKIFNKKVAIKIYEKQRIKEPQRKKSVRREIKLLQMLNHQNVIK
VYDTIETNNHVNIIMEYIPGTSLHGYLKAQPNRRLTENDAKRIFKQLVSSIEYIHSKQIC
HRDIKLENILLDENNNPKLIDFGFSTCIPNDQKYKMFCGTPSYMAPEIVNKREYTGPPAD
IWALGVLLYALLCGTFPFKGQTDKELYKKITKGDFLSPDFLSKEARDFIKWVLNTDCDLR
PTATEVLSHPWLGGKKNTFMQNQNPSSHQQSSISSNPQSSQNQQISISGNQQSNNFDNNL
QQLQQQQQQQQQQQQQIQQQQQQLVLNGGNCNSNTNSSSTILVNNYLQLNSPFNSNLKQF
KFNNPQKTPSSASGIHMQLGNLGNISTPSNMGQQINFTNNQENNFPQKSNEKDKFMSPNN
LFYYPNKPNATNVMTPSQQNNNNINNNTNQNNSNYFINNKNIVIQLNNNDGNSPTSKPPL
PLTTKSSSCNYQNYFISNNNPSSNNINNNNNNGNNTFSDSPMNYNSTYHNLQKRHEKRME
LFRNSQDYVQQPNSGDCTYISDKNNQSSNNMNINPYNHPVHHLNTQGSSNNINTTGNGHS
TQNFALHHLNDDEPINSIDSDVLKSIVYMGYTNDEETLVNGIRDPKNPLFNLYKKIYNKK
VHQNKTIYPSHMPGTSFISSLGSVKSPQSSSVNNNVSCNRGGYKKVINFGNSYNQEQNTF
NQSFNNNVNPLSTKNIMGGIIPSSTTNSNNNNTNILNSGSFLNTTSNNILNNTTINKFYE
QEVVIGQNIQQQQQQQQFY


>TTHERM_00037530(gene)
ATGGACGCATATTCTGGATGCAGCAGCACTAAATAGTAATACAAGAATATTCGCATGGAG
GATATCTAAGCTATGATGAGTACTTACTAATTTACTTGACTATTTTAAACAAAAACAAAA
AGAAATATGATGAAACATTTTCATTTAGTTTAAATAAAAATTTTTTGAATTCAAATTTTT
TTTATCGAGAAACAAATATTCATTTTAATACTTTTGATAAAAGATAAGGGGTACTCTTCA
ACTAAGAATAATAATTCATCAGCGTCTTTGGCAGAAAGAATACGCAAAATGTATAGAAAC
TAAGTTGGAAATACACCCTCAAGCAGTTAGGGAAATGGAAATGGTTTAAATTAAGGGATA
TAAATAGGAGGGAATGTCTAATTATAGTAAAATGCAAATAATCTAAGCAGCAATAACATG
AATAATGCAGGTTCTAAGGGCAACTTGAAGGACTTGCTTGATAATTTTTACAAAAGAAAT
TCAAAATCTCCTTAATAAAGCAATAGCAATACAGCTACAAACACAAGCATTTTATCATAA
AATACTAACATAGCTAATGGATCTATGGGTATAATTAACCAATAATACTCTAACTAAAAT
AATGTAAACAAAATGATTGAAAGAACTGGAGCTAAGGCTTCCGAAGGACTGAAAAATTAT
GTCACAAATATTATTATGAAGAAGATGAGTAAAGAGGATTTAAAAAACAATTAAGAAAAT
ATACAGTCTTACGCCTAAGCTTCTACAAACAACAGCACTTCTTAAAACTCTTTTTACAAG
AAAAAGAGTCACTCAATAAGCAACAAATACTAAACTGGTTAGATTATTAATTCTTCCATA
TCAAATTAACCTACAGGTCTTTCAACTCAGCCATCAGCACAGTAAATTAAATAACAAAAA
GATAGCTCATATCATTTTATCAATGAATTTAAATTCATAATGAATATTCAAAAAGCTAAA
GTTTAAATGCGAAAAGATATTCGTTCTATAGATTTTATTATTTCAAAGGGTATATGGTTG
TTAAAATCTTAAAATTTAGGTTTTGATTTAGTTTAAAATAAATGCACACATTAATAATAT
ATTTAATGTATTTATGAATGAGTGAGTAAATTCGTTATTTAGCAACACTGAAAGATGAAT
GAAAGCGCAATATTTTTGATAAATTCAAAATAGTTAAATTAGATAGATGAATAAGTAAAT
AGATACATACATACCTAAATAAATAAATAATAATTTGAATACTCTTTGATTTGTTGTGTA
AAAAAATTAATTAAGAAAAGATAAATTTTTTTAGGACATTCAAAGATTTTTAATCAAATT
TACTTTCAAATTCAAAAATAAGATAGGCAGCCTCCCCAAATAAAAACATCCTCTTTTTTA
CAATCATTATTTTTTGATTATTTGTTTGATTGTTTATTATTGCATTATTTTTTTTATAAT
CAAACAAATTCAATTGAAATCTAAACTGATATTTTTTTGCTTCTAAATTATTCTTTTCGC
ATTCATTCACTATTAGGAACATAAAAATCTTTTTTTTATTTCTTCCATACATTTTTTCTA
TGATCTACTTGTTCTGCAATTTGAATTTTTTTTTTTTTTTTGCAATTTAAACTTAGCCTT
ATTTTTGTGAGCATATTTAAAGTGAATTCAAATTCAAAATTAATCTAAAACTGACTACTA
GATTTTAATTTCTAACTTATTAAAAATAAAAAGGAGGTACGCCTATTCAAATTAAAGACC
TTCTCAAAAATTGAATGAAACTGACTTAAATCTTCTAAATAAAGTATTTTTAATCTCTCA
ATATTTTATTTAACTTATTTACTTTATATTAGACTATTGGAAATAATAATTTGAATAACA
TAAGCGGACAGTAATCTTACTCTCCTTGCACAAAAGCTGCATTGTAATATCATTAGTAAT
AAATGCAATATGCTAAAGAACCATTATAGCCTCACTATGCTCCTCATTCAAACTAACAGC
AATAACTACTACTTCAATCATAGGCTAAATCTAATTAAATTAAAGACGTTAGAGGAATTG
ATATTTTAAAAAGCCCAACAAATTAGTAATAATCAGTTTAAAAGAAGAGACCAAAAACTA
TAGCTAATAAGGAAAATGCTTATGGAAATAATGAAAATGTAAATTACACCTAATTAAATA
ACTCGTCAAATGTGTTTACTTCTTCTACTTAACAATAATTTAACATGTTAAATTCCTCAT
CAAATTAAGTAAATACTCCAACGAATAACAATATCAATTTAAACAGCTACAACAATAACG
GTTAAAGCAATAACAAATATAGAGAAATAAGTATAAGACTTAATAATTCAAGTGAGTTTT
TGAAAAACTATTAAAAGATTACAAGGGAAAAAAGCTCAGAAACCTGCACCAATTAATCTA
AAGAGATTATTTCTTTCAATCAATAGTAAATTTAACCTTAGAATTCTAAACGTGCTCTCT
CAACAGGATTAAAACCAAATACTATCATTCTAAATTAAAATTGTATTTAAACTAGTTAGA
ATTATAATCCAAATGGTGTAATGCTAAATAATTAAGGGAATAGCAATATCAGTCATTCTT
ACTTAAACACAACCCATTTAAATAATAACAACAGCGGAAGTGGAAGTAACTTGCTACTTA
ACAACATAAATACAAACAGCAATAACAATATCATAAATTAAAATACATAGGCTTCTCCCT
TGAACAGTAGTCATCATAAAAATAATAGCTCGTTAAATTATTACAAGCAACAAATTTAGT
AAACTAGCAAACCTATGCTGGTTTAACAATAATAATAGGTTGTTTAATAACAATAATAAT
AATAGTAATAATAGCAATTACAAATTCAGTAACAATAACAGCTTTAATAACAATTTTAAA
CTAACTCATCAAATAACTAGCAGTTGTAACAAATAAAAATACAATCAACCAAAGAAAATA
AAAAAATTGAATTTCCATCATATTTGGGATAGTAAATTTTGACTTGTGATAATAAGAGAA
AGTAAAATGAACATTTTTAGTTTGACTTCCCAAGCACAACAACAAATGCTACAGCAGTAA
AATTGAATTAAAATACTTAATCTTCATTACAGTCAAATACAATTTAAAATGCTACTATTT
TGCAAACATAGCAAAATAACTAAAGTAATTCTGGAGTTAAAAATTATGATGCTTAATAGA
TTACGACAACTGTTACAAATACTTAAGTTTATGATTGTGAAGAAAATACCACTACTGCTA
AAAAATAAAAACCTACTAGCACTGAGCCAAATGGAGTTTCTGCAGCAGCTTAATACCCTT
TGTCAGGAATATAACAAGTAAATTAAAACATCGCTGCACCTTAAAATGCTCCTTACAATC
CATTCTCTAGCAACGGTACTCCAAAAGATCACGCTGACAATATTAGATTCTTAAATGATG
ATTCTAAGTGCTACGAGCCCGATAAGTTCTTATCTGCTCTTCCTGAAGAGAAGGAACGAA
AAATTATTCAAGTAAGATTTTTATTTTTTAATTATATTAAAGGAGTACTTTTGTGAATAA
TAGTTTTAAGATGATAACATAGACAAGACACAAAAATTCAAGGAAGAATATCTTGTTGGT
AAACAAGTAGGGCAAGGCGCTTATGCCACTGTAAGAGTTGCCTTAAATAAAATATTCAAC
AAAAAAGTAGCTATAAAGATTTATGAAAAGCAAAGAATAAAAGAACCCCAAAGAAAGAAA
TCAGTTAGAAGAGAAATAAAACTTTTACAAATGCTAAACCATTAGAACGTTATCAAAGTT
TACGACACAATAGAAACTAATAACCATGTAAATATCATTATGGAATATATTCCTGGTACT
TCTCTCCATGGATACTTAAAGGCTTAGCCCAATAGAAGACTCACTGAAAATGATGCCAAA
AGGATATTTAAACAACTTGTTTCGTCTATTGAGTATATTCACTCAAAATAAATTTGCCAC
AGAGATATCAAATTAGAAAATATTCTCCTTGATGAAAATAATAATCCTAAATTAATTGAC
TTTGGATTTTCTACTTGCATCCCAAATGATTAAAAATATAAAATGTTTTGTGGTACCCCT
TCATATATGGCACCTGAAATTGTTAATAAAAGAGAATATACTGGTCCACCTGCTGATATT
TGGGCTCTTGGTGTCCTTCTATATGCATTACTATGTGGCACATTCCCTTTTAAAGGTAAA
GCAAGCATTTAAAAAAAAATTTTTTAACTTCTTTTTCATCAATTTAAAAAGGATAAACCG
ATAAGGAACTCTATAAGAAAATAACCAAAGGTGATTTCCTTTCTCCTGATTTCCTTTCAA
AGGAAGCTAGAGATTTTATCAAATGGGTATTAAATACAGATTGTGACTTAAGACCAACTG
CAACAGAAGTAATAAAAATATTAATTAAAACATTTTTGTAAGAATTGTTACAAAAATTAA
AAAAATTTCATTATAAAATAAAATTTTTTAAAAATATTTTAAATTTGTTTATTAAAAATT
TTTTAATTTAAAATATACTATCTAAAGGTTTTAAGTCATCCTTGGTTGGGAGGAAAGAAG
AATACCTTTATGTAAAATTAAAATCCTTCTTCTCATTAGCAATCTTCTATTTCTTCAAAT
CCTCAATCATCATAAAACTAGTAAATATCTATAAGCGGAAATCAGCAATCAAATAACTTT
GATAATAATCTCTAATAATTACAATAGTAATAATAATAATAATAACAATAGTAATAGTAA
ATTTAACAACAGCAATAGCAACTGGTGTTAAATGGTGGTAATTGCAATTCTAACACGAAT
TCAAGCAGTACTATCTTAGTAAATAACTATCTATAATTAAATAGTCCTTTCAATTCTAAT
CTGAAACAATTCAAATTCAATAACCCTCAAAAGACACCTTCTTCAGCATCAGGAATACAT
ATGCAACTTGGTAATCTTGGCAACATCAGCACCCCAAGTAACATGGGACAACAAATTAAT
TTTACAAATAATTAAGAAAATAACTTCCCTCAAAAATCTAATGAAAAAGACAAATTTATG
TCTCCAAATAATTTATTTTATTACCCTAATAAGCCTAATGCTACAAATGTAATGACTCCT
TCTTAGCAAAATAATAACAATATTAATAATAATACTAATTAGAATAATAGCAATTACTTT
ATTAATAATAAAAATATAGTAATTTAGTTAAATAATAATGATGGAAACAGTCCAACATCT
AAGCCCCCTCTTCCTTTAACAACTAAGAGTTCTTCGTGCAATTATTAAAATTATTTTATT
AGCAACAACAATCCTTCTAGTAATAATATTAATAATAATAATAATAATGGAAACAATACA
TTCTCTGATAGTCCTATGAACTATAATTCAACCTATCACAACTTATAGAAAAGACACGAA
AAGCGCATGGAACTATTTAGAAATTCTTAGGATTATGTTTAATAGCCTAATTCAGGAGAC
TGCACTTATATTTCTGATAAAAATAATTAATCAAGTAATAACATGAACATTAATCCTTAT
AATCATCCTGTACACCACCTTAATACCTAAGGAAGTAGTAACAACATAAACACAACTGGA
AATGGCCATAGTACATAAAACTTTGCCTTACATCATCTGAATGATGATGAGCCTATCAAT
AGCATTGATTCAGATGTCTTAAAAAGCATTGTAATTTTTTTTTTTTAATTTTCAAACAAA
TAATTGATAAAATGATTTAATAAAAAAGGTTTATATGGGATATACTAATGATGAAGAAAC
ACTAGTTAATGGTATAAGAGATCCTAAGAATCCACTTTTTAATCTCTATAAGAAGATTTA
TAATAAGAAAGTTCATTAAAATAAGACTATTTATCCCAGCCATATGCCAGGAACATCATT
TATAAGCTCTTTAGGGTCTGTAAAGTCTCCTCAATCTTCTTCTGTTAACAACAATGTATC
TTGCAACAGAGGTATAAAATTAATTTAGTTTTTAAAAAAATTTACAAATAAAAAATTAAA
AATAAATAGGCGGATATAAGAAGGTTATAAATTTTGGTAATAGTTACAATCAAGAGCAAA
ATACTTTCAATTAAAGTTTTAATAACAACGTTAACCCTCTTTCTACTAAAAATATAATGG
GAGGTATCATTCCTAGCTCAACAACAAACAGCAATAACAATAATACTAACATTCTTAATA
GTGGCTCATTTTTAAATACAACATCTAATAATATTTTAAACAATACAACAATTAATAAAT
TTTATGAGCAAGAAGTAGTTATTGGATAAAATATTTAATAATAATAACAATAATAACAAT
TCTATTGA