Identifiers and Description

Gene Model Identifier

TTHERM_00035630

Standard Name

None

Aliases

PreTt14397 | 2.m02178 | 3825.m02773

Description

brix domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00035630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00945.14.999394169176705e-180brix domain-containing protein
(342 aa)
OxytrichaContig16925.0.g736.998463833652622e-61Transmembrane amino acid trans
porter protein
DictyBaseDDB_G02922161.0000099287337047e-53bxdc1 on chromosome: 6 positio
n 1328996 to 1330184
WormBaseWBGene000218302.999661265281073e-47Ribosome production factor 2 h
omolog status:Confirmed Un
iProt:Q9N3F0 protein_id:CCD7
2829.1
SGDYKR081C5.999907735769095e-44RPF2 Essential protein involve
d in the processing of pre-rRN
A and the assembly of the 60S
ribosomal subunit; interacts w
ith ribosomal protein L11; loc
alizes predominantly to the nu
cleolus; constituent of 66S pr
e-ribosomal particles
Stentor CoeruleusSteCoe_73078.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00035630(coding)
ATGGAAATTGTTGATAAAGAATAGAATTTAGCCAAAATTGATAAGGAAATTCGTACTCCT
AAAACTGCTAGAGGTCGTAGACTCTTAAAGAAGAGAGAGCCTCAACTCGAAGAAGGCAGC
AAAAAGACAATTTTCATTAAAGGAAAAAAAACTTCAGAAGATGTTTCAAAGATAATGAAG
GACATTTACACTTTGAAAAAAATCAATTCTGTCAATTTTTCTAATAGACATGATGTTTTA
CCTTTTGAAAATGTTTAACCTATTGAAAATTATTGCAGCAAGCAAGATTGCAGTCTCTTC
GTTTTTGGCTCCCACAATAAAAAGAGACCTGATAATCTCATTCTTGGTAGATTATTTGAT
GGACATCTTCTTGATATGGTAGAATTTGGAGTCAGCAACATGAAATCTCAATCTAGCTTC
ACAAGTATTATCGATATTCCTTCTTAAGCTCGTCCTGTTTTAGTTTTCTAAGGTCCTCTC
TTCGATTCTGAACCTACCTTTATGAAAATTAAGAACCTTTTAAATGATTTCTTTGTCGAA
AACATCAACGTAGCTGAAATAGATATTATGACTGGTATGAGATATACAATAGTTTTTACT
GCTAATGAAAAAAATATTTTGATGAGAACTTATGCTATAAATATCAATAAAAGTGAAGTT
AATAAGGAAGATTTATAATCAAATAGTAATGCATCTGCAATATAATTAACTGAAATAGGG
CCCTCTGCTGACCTTACAGTTAGAAGAGAATAATGGGCTTCTGATGAAACTATGAAAGTT
GCCTGCAAACAACCTAAAGTAGTCAAGAAGAAACAAGATAAAAATAAATTCACAGATGCA
TTGGGCAATACAGTTGCTAAAATCTATACTAACCATCAAAACTTTAATGTGTTAGCTCTT
AAAAAGAGAAAGAAACTAAAAACTAACAGCGGAGAAGAAAAAACTATCGATGTCGACGAT
TTGTGA


>TTHERM_00035630(protein)
MEIVDKEQNLAKIDKEIRTPKTARGRRLLKKREPQLEEGSKKTIFIKGKKTSEDVSKIMK
DIYTLKKINSVNFSNRHDVLPFENVQPIENYCSKQDCSLFVFGSHNKKRPDNLILGRLFD
GHLLDMVEFGVSNMKSQSSFTSIIDIPSQARPVLVFQGPLFDSEPTFMKIKNLLNDFFVE
NINVAEIDIMTGMRYTIVFTANEKNILMRTYAININKSEVNKEDLQSNSNASAIQLTEIG
PSADLTVRREQWASDETMKVACKQPKVVKKKQDKNKFTDALGNTVAKIYTNHQNFNVLAL
KKRKKLKTNSGEEKTIDVDDL


>TTHERM_00035630(gene)
ATGGAAATTGTTGATAAAGAATAGAATTTAGCCAAAATTGATAAGGAAATTCGTACTCCT
AAAACTGCTAGAGGTCGTAGACTCTTAAAGAAGAGAGAGCCTCAACTCGAAGAAGGCAGC
AAAAAGACAATTTTCATTAAAGGAAAAAAAACTTCAGAAGATGTTTCAAAGATAATGAAG
GACATTGTAATTAATTAATTAAATATTTTGATTGCTTTCTTTTTGAATATTAACTTCTGC
TACTAAAAAAATAAATTTATGATCTTGGAATAGCAAATATGAACTTTCTTTTTTAAATTA
AAATAGTACACTTTGAAAAAAATCAATTCTGTCAATTTTTCTAATAGACATGATGTTTTA
CCTTTTGAAAATGTTTAACCTATTGAAAATTATTGCAGCAAGCAAGATTGCAGTCTCTTC
GTTTTTGGGTATTTATTATTTTATTACATTTTAGCAAGCAATGATTACAATTTTTTTATA
CTAAATCAAGCTCCCACAATAAAAAGAGACCTGATAATCTCATTCTTGGTAGATTATTTG
ATGGACATCTTCTTGATATGGTAGAATTTGGAGTCAGCAACATGAAATCTCAATCTAGCT
TCACAAGTATTATCGATATTCCTTCTTAAGCTCGTCCTGTTTTAGTTTTCTAAGGTCCTC
TCTTCGATTCTGAACCTACCTTTATGAAAATTAAGAACCTTTTAAATGGTAATTAAGCAA
AATGAATACATAAAATTTATAAAAAAAAAGAATTATTTTTTAAAGATTGAACTTGGAGCA
AAAAAATTTCAAAATGAAAATATTAATATTTTTTAATTTATTTTTTAGATTTCTTTGTCG
AAAACATCAACGTAGCTGAAATAGATATTATGACTGGTATGAGATATACAATAGTTTTTA
CTGCTAATGAAAAAAATATTTTGATGAGAACTTATGCTATAAATATCAATAAAAGTGAAG
TTAATAAGGAAGATTTATAATCAAATAGTAATGCATCTGCAATATAATTAACTGAAATAG
GGCCCTCTGCTGACCTTACAGTTAGAAGAGAATAATGGGCTTCTGATGAAACTATGAAAG
TTGCCTGCAAACAACCTAAAGTAGTCAAGAAGAAACAAGTATATATTTTTTAATAACTTA
AACAAATAAATAAATAAATTACTTTTTTTAAATCAAATTAGGATAAAAATAAATTCACAG
ATGCATTGGGCAATACAGTTGCTAAAATCTATACTAACCATCAAAACTTTAATGTGTTAG
CTCTTAAAAAGAGAAAGAAACTAAAAACTAACAGCGGAGAAGAAAAAACTATCGATGTCG
ACGATTTGTGA