Identifiers and Description

Gene Model Identifier

TTHERM_00035540

Standard Name

None

Aliases

PreTt14388 | 2.m02118 | 3825.m02766

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00035540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00938.19.997093137033517e-262hypothetical protein (931 aa)
DictyBaseDDB_G02885471.000361553249356e-16DDB_G0288547 on chromosome: 5
position 1676407 to 1677541
OxytrichaContig19029.0.g570.000000000000001999258566166494RNA cap guanine-N2 methyltrans
ferase
WormBaseWBGene000116310.0000000000010000211161514907status:Confirmed UniProt:Q94
013 protein_id:CAB02307.2
SGDYPL157W0.00003998524687536623TGS1 Trimethyl guanosine synth
ase, conserved nucleolar methy
l transferase that converts th
e m(7)G cap structure of snRNA
s, snoRNAs, and telomerase TLC
1 RNA to m(2,2,7)G; also requi
red for nucleolar assembly and
splicing of meiotic pre-mRNAs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00035540(coding)
ATGGAATAGTCGTTGCTTAATAAATAAGAAAAGTAGTAGTCTTAACCAAGAAAAAAAAAA
TAAGTATTTTGCTGTTGTTTTGGCGGAGGAGACGATGTAGAAACTGATGAAGAATAACAT
CATCAAGAAAAGTAGTAGTCTTAACCAAGAAAAAAAAAATAAGTATTTTGCTGTTGTTTT
GGCGGAGGAGACGATGTAGAAACTGATGAAGAATAACATCATCAAGAAAAGTAGTAGTCT
TAACCAAGAAAAAAAAAATAAGTATTTTGCTGTTGTTTTGGCGGAGGAGACGATGTAGAA
ACTGATGAAGAATAACATCATCATTAAGGTTAATAAGAACCTAATTATTTTTAGCAAAAT
AGTTAGGATGTAAATAATACAACAACAATTCCTTGTATGAGTAATATTTCATAGCCAAAT
AGCGAAATCTATACAAGTTAAGGTTACGCTTAATAAAGTAAAGCTAAAAACTCTCCACAA
AAAGAAAGAAAGAGAGATATGCAATCTTCTTCTCATAACAGCCGCGTGATAAAAGAGTAA
GGGGAAGAAAATAATAGCAGCAGTTCAAGTAATTCCACAAATAATTAATAATAAAATTAC
CAAAAGTCTTAAAATTAGAACATAAATGAGTATAATACCCCTAATCCATAGTAAAATGCT
ATGAGTAAAAATACGTTAAAAATATAATCTCATAAAAAATCCACAGAGTAATCATATACA
AATGAGCATGATACTTATTTGAATTTCGATTAGAGCAGCCAAGCATTAAATGCAGATTTA
AACCATTCTTTGTAAAGCAAAAATAATCTCAAAAACTCAGTTAAGAAAGCTAAGTACAAT
ATAAAAGCGTTTTTGTAATAATACAAGCAGCAATAAACTGATCTTTTCCATCTGTATTGT
AAAAAGAAAGAAAGCTATTTATTAGTCAAAACCTTGGAAAAGAATTTCTAGAGTAACTCA
TTCTTGAATTCTCAGGTAAATCAAAACCCCAGCAAGCAAAGTATCTGCTAAAAAGGAGTA
GTTTCTACTGATCCAAATAGTTACTTTTACAACAGAAATTTCAAAAGTGATTTTGACAGC
TAATTTAATGCAATTCCTGAGCCGATTTGCTAATATCTTTCATCTAGATTAAAAAATCAA
ATTGTTGTAGACGCCTTTTGTGGAGTAGGTTACAATACAGTCTAATTTGCTAAAGAAGCT
AGCTAAGTGATTGCTATTGATTGCAATTAGGTTAAAGTAAGCCATGCTAAATACAATATT
GAATCATTCAAATAACAGCATAAAGTTGAAGTAATTTAATCTGATTTCCTTCAAATGAAA
AAGTTGAAAGCGGATACAGTAGTTCTTCATCCTGACTACAAAAAATTTGATAACTCAATT
TCTTCTTCCTAAGGTATTGATAATTCAATTAACCTACTTACAGAAGTATAGCCAAATCTC
GTAGAAGCTCTTAAACTCTCATTTAAAATTTCAGACAGTGTTGTAATCATACTTTAAAAA
AGTTGTGATATCCAACAGCTCCCTCAAGTATTAGAGCAAGCTAATTATCCATATAAAAAA
TTCGCTGTTGAAATCGAACTAATGCATATTGACAGAAAATTCAACCTTGCTCTCGTTTTT
CTTGGAGATATTGCCCAAGTAAGCAAGGAAGAAGTTGTAGAGTATTATACAAAATTATTA
TACGAAAGTTCAGATGTTTAAAATTAAATATTCATGAACAAGATCAAGAGTATTCTAGTG
CATATAATGCATACAAGTAAAATCAAAGGAGTTTCTTAGTTAATCGAAAATTGTGAAAAA
TCTGTAGCCTCTCAGCAAAACAGAAAAACTTTATTCCAAGAGTTTTATGATTGCTTAAGT
GAAAAAAAAGGAAGGATCAGAAGCAGTGGTAATTTACAGTTCGAAGCTGATAGTATAGTA
ACTACTGATAAATCACTAAAGCAACTTATAAGAGATATTGACGATATATTATCCGCTAAT
TAAAAAAGTAACTTTAAATCTTAAAGTCCTTCTAGTAATGAAGACTTAGGAAGTTACAAT
TACAAGTTTGATTTTGAAGGAAGTAATAAGTTTAATGGAAAGCCTAAAAAAAAGGCTTAA
TTTAACTAAAGTATGCAAGAAACAGCCCATGATAATTCTAGTAGCTAATCTCTTATTAAA
AGTGCACTTACCAAGAAATAAGTAAAGGGGTTAAATAAGAACACTGTCCAACAATTGAAA
AAAAGTGAGCAAAATAATAGTATAATGAGTAAAGGATTTAAAAATAGTGATTTAAGTAAT
AATAATTAAAATGCAGGAAACAATTAAAATAATTAAAGTGAAGATAATCTTAGCGAAAAT
CATAACGAATATGAATACCATACTAGTCAATATAATGATGAAGACTATGGAGACAGCATT
CCTAAAATTATTTATTCTTGCTCCTACGAAACAAACTAATTAATTGATTCAGAGGGTAGT
GAAAATAACAGTTTGCGTCCTCAATTCAGTAATGGAATCTACTTCAACTAATCTACTGAT
GTTTACGATGAATAGGAATTCAGAGCAAGCATAATGAATTTAAAAGGCGGTAGCAACTAC
TATGATCGCCCATTAGTAAAACACACTAACTCGGCTGGTGGAATATTAGGCTTTACAAGA
GAGTAGTTCCTTAATGCAAGCATTTAAACTAATGGATCAGGAAAAGGTCAAACGATTTTA
ATAGGAACAAAAAGCCAAAAAAATAATGAAAGCAAAAATAATTTATCAGGATATGATGAT
AACATGAGTAACAATAGATCTGCATCAAAATTAAATTAATATTATTAGCAAGATTTTTAA
GAAGACTGTGCTGAGTTTGACTGGTAATAAGAAGAAGGTACAGAAAATAGCTTTTAACAA
TAACCTAAATAGACATAGACAAAAATAAAAAATAATATCAATACTTTTTAGAATAACCCT
GACCTAGATGAGTCATATAAGAATACCAAAATATAAACTGTCCCAAATAGTTTATCTTGA


>TTHERM_00035540(protein)
MEQSLLNKQEKQQSQPRKKKQVFCCCFGGGDDVETDEEQHHQEKQQSQPRKKKQVFCCCF
GGGDDVETDEEQHHQEKQQSQPRKKKQVFCCCFGGGDDVETDEEQHHHQGQQEPNYFQQN
SQDVNNTTTIPCMSNISQPNSEIYTSQGYAQQSKAKNSPQKERKRDMQSSSHNSRVIKEQ
GEENNSSSSSNSTNNQQQNYQKSQNQNINEYNTPNPQQNAMSKNTLKIQSHKKSTEQSYT
NEHDTYLNFDQSSQALNADLNHSLQSKNNLKNSVKKAKYNIKAFLQQYKQQQTDLFHLYC
KKKESYLLVKTLEKNFQSNSFLNSQVNQNPSKQSICQKGVVSTDPNSYFYNRNFKSDFDS
QFNAIPEPICQYLSSRLKNQIVVDAFCGVGYNTVQFAKEASQVIAIDCNQVKVSHAKYNI
ESFKQQHKVEVIQSDFLQMKKLKADTVVLHPDYKKFDNSISSSQGIDNSINLLTEVQPNL
VEALKLSFKISDSVVIILQKSCDIQQLPQVLEQANYPYKKFAVEIELMHIDRKFNLALVF
LGDIAQVSKEEVVEYYTKLLYESSDVQNQIFMNKIKSILVHIMHTSKIKGVSQLIENCEK
SVASQQNRKTLFQEFYDCLSEKKGRIRSSGNLQFEADSIVTTDKSLKQLIRDIDDILSAN
QKSNFKSQSPSSNEDLGSYNYKFDFEGSNKFNGKPKKKAQFNQSMQETAHDNSSSQSLIK
SALTKKQVKGLNKNTVQQLKKSEQNNSIMSKGFKNSDLSNNNQNAGNNQNNQSEDNLSEN
HNEYEYHTSQYNDEDYGDSIPKIIYSCSYETNQLIDSEGSENNSLRPQFSNGIYFNQSTD
VYDEQEFRASIMNLKGGSNYYDRPLVKHTNSAGGILGFTREQFLNASIQTNGSGKGQTIL
IGTKSQKNNESKNNLSGYDDNMSNNRSASKLNQYYQQDFQEDCAEFDWQQEEGTENSFQQ
QPKQTQTKIKNNINTFQNNPDLDESYKNTKIQTVPNSLS


>TTHERM_00035540(gene)
ATGGAATAGTCGTTGCTTAATAAATAAGAAAAGTAGTAGTCTTAACCAAGAAAAAAAAAA
TAAGTATTTTGCTGTTGTTTTGGCGGAGGAGACGATGTAGAAACTGATGAAGAATAACAT
CATCAAGAAAAGTAGTAGTCTTAACCAAGAAAAAAAAAATAAGTATTTTGCTGTTGTTTT
GGCGGAGGAGACGATGTAGAAACTGATGAAGAATAACATCATCAAGAAAAGTAGTAGTCT
TAACCAAGAAAAAAAAAATAAGTATTTTGCTGTTGTTTTGGCGGAGGAGACGATGTAGAA
ACTGATGAAGAATAACATCATCATTAAGGTTAATAAGAACCTAATTATTTTTAGCAAAAT
AGTTAGGATGTAAATAATACAACAACAATTCCTTGTATGAGTAATATTTCATAGCCAAAT
AGCGAAATCTATACAAGTTAAGGTTACGCTTAATAAAGTAAAGCTAAAAACTCTCCACAA
AAAGAAAGAAAGAGAGATATGCAATCTTCTTCTCATAACAGCCGCGTGATAAAAGAGTAA
GGGGAAGAAAATAATAGCAGCAGTTCAAGTAATTCCACAAATAATTAATAATAAAATTAC
CAAAAGTCTTAAAATTAGAACATAAATGAGTATAATACCCCTAATCCATAGTAAAATGCT
ATGAGTAAAAATACGTTAAAAATATAATCTCATAAAAAATCCACAGAGTAATCATATACA
AATGAGCATGATACTTATTTGAATTTCGATTAGAGCAGCCAAGCATTAAATGCAGATTTA
AACCATTCTTTGTAAAGCAAAAATAATCTCAAAAACTCAGTTAAGAAAGCTAAGTACAAT
ATAAAAGCGTTTTTGTAATAATACAAGCAGCAATAAACTGATCTTTTCCATCTGTATTGT
AAAAAGAAAGAAAGCTATTTATTAGTCAAAACCTTGGAAAAGAATTTCTAGAGTAACTCA
TTCTTGAATTCTCAGGTAAATCAAAACCCCAGCAAGCAAAGTATCTGCTAAAAAGGAGTA
GTTTCTACTGATCCAAATAGTTACTTTTACAACAGAAATTTCAAAAGTGATTTTGACAGC
TAATTTAATGCAATTCCTGAGCCGATTTGCTAATATCTTTCATCTAGATTAAAAAATCAA
ATTGTTGTAGACGCCTTTTGTGGAGTAGGTTACAATACAGTCTAAGTAAGCTTTTATATT
GACTTTTCAAAATTAATTTTATTATCTTATATAAGCTAGAAAGAAAAAAAAATTATTTTA
TGAGAAGATTAATATTTATTATTGGCTTATTTATTTTTTTATTTATTTGCAGCATTACAA
AAAAATTGGAATAAAATTATAATTTTATAAAAAAAGTTTGCTAAAGAAGCTAGCTAAGTG
ATTGCTATTGATTGCAATTAGGTTAAAGTAAGCCATGCTAAATACAATATTGAATCATTC
AAATAACAGCATAAAGTTGAAGTAATTTAATCTGATTTCCTTCAAATGAAAAAGTTGAAA
GCGGATACAGTAGTTCTTCATCCTGACTACAAAAAATTTGATAACTCAATTTCTTCTTCC
TAAGGTATTGATAATTCAATTAACCTACTTACAGAAGTATAGCCAAATCTCGTAGAAGCT
CTTAAACTCTCATTTAAAATTTCAGACAGTGTTGTAATCATACTTTAAAAAAGTTGTGAT
ATCCAACAGCTCCCTCAAGTATTAGAGCAAGCTAATTAGTAAAACAATTTATTCGCTTTG
TAAAAAATATTTAGTTTTAAAATTTATTTAAAGTCCATATAAAAAATTCGCTGTTGAAAT
CGAACTAATGCATATTGACAGAAAATTCAACCTTGCTCTCGTTTTTCTTGGAGATATTGC
CCAAGTAAATTTTAAAAATTAAGAATTTTATTAATTCAATTTATTTTTTTTATCTTGAAT
TAAAAAAATATTTATTTTTCTTAAAAATTTTAAATAATCCTGAAAAGTTATTAATAAATT
TTAATGAAAACTTTAGGTAAGCAAGGAAGAAGTTGTAGAGTATTATACAAAATTATTATA
CGAAAGTTCAGATGTTTAAAATTAAATATTCATGAACAAGATCAAGAGTATTCTAGTGCA
TATAATGCATACAAGTAAAATCAAAGGAGTTTCTTAGTTAATCGAAAATTGTGAAAAATC
TGTAGCCTCTCAGCAAAACAGAAAAACTTTATTCCAAGAGTTTTATGATTGCTTAAGTGA
AAAAAAAGGAAGGATCAGAAGCAGTGGTAATTTACAGTTCGAAGCTGATAGTATAGTAAC
TACTGATAAATCACTAAAGCAACTTATAAGAGATATTGACGATATATTATCCGCTAATTA
AAAAAGTAACTTTAAATCTTAAAGTCCTTCTAGTAATGAAGACTTAGGAAGTTACAATTA
CAAGTTTGATTTTGAAGGAAGTAATAAGTTTAATGGAAAGCCTAAAAAAAAGGCTTAATT
TAACTAAAGTATGCAAGAAACAGCCCATGATAATTCTAGTAGCTAATCTCTTATTAAAAG
TGCACTTACCAAGAAATAAGTAAAGGGGTTAAATAAGAACACTGTCCAACAATTGAAAAA
AAGTGAGCAAAATAATAGTATAATGAGTAAAGGATTTAAAAATAGTGATTTAAGTAATAA
TAATTAAAATGCAGGAAACAATTAAAATAATTAAAGTGAAGATAATCTTAGCGAAAATCA
TAACGAATATGAATACCATACTAGTCAATATAATGATGAAGACTATGGAGACAGCATTCC
TAAAATTATTTATTCTTGCTCCTACGAAACAAACTAATTAATTGATTCAGAGGGTAGTGA
AAATAACAGTTTGCGTCCTCAATTCAGTAATGGAATCTACTTCAACTAATCTACTGATGT
TTACGATGAATAGGAATTCAGAGCAAGCATAATGAATTTAAAAGGCGGTAGCAACTACTA
TGATCGCCCATTAGTAAAACACACTAACTCGGCTGGTGGAATATTAGGCTTTACAAGAGA
GTAGTTCCTTAATGCAAGCATTTAAACTAATGGATCAGGAAAAGGTCAAACGATTTTAAT
AGGAACAAAAAGCCAAAAAAATAATGAAAGCAAAAATAATTTATCAGGATATGATGATAA
CATGAGTAACAATAGATCTGCATCAAAATTAAATTAATATTATTAGCAAGATTTTTAAGA
AGACTGTGCTGAGTTTGACTGGTAATAAGAAGAAGGTACAGAAAATAGCTTTTAACAATA
ACCTAAATAGACATAGACAAAAATAAAAAATAATATCAATACTTTTTAGAATAACCCTGA
CCTAGATGAGTCATATAAGAATACCAAAATATAAACTGTCCCAAATAGTTTATCTTGA