Identifiers and Description

Gene Model Identifier

TTHERM_00022810

Standard Name

None

Aliases

PreTt11993 | 1.m01041

Description

Phosphoenolpyruvate phosphomutase precursor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR02317 ) methylisocitrate lyase
  • ( TIGR02321 ) phosphonopyruvate hydrolase
  • ( TIGR02320 ) phosphoenolpyruvate phosphomutase
  • ( TIGR02319 ) carboxyvinyl-carboxyphosphonate phosphorylmutase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13843.19.997093137033517e-262phosphoenolpyruvate phosphomut
ase (302 aa)
OxytrichaContig13562.0.g17.000924640675686e-24Phosphoenolpyruvate phosphomut
ase
SGDYER065C0.00008003872323201264ICL1 Isocitrate lyase, catalyz
es the formation of succinate
and glyoxylate from isocitrate
, a key reaction of the glyoxy
late cycle; expression of ICL1
is induced by growth on ethan
ol and repressed by growth on
glucose

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00022810(coding)
ATGTTGGCTAACAGTCTTAAGAACTTCTTCTCTTCTGCTCCCAGAAAGACCACCTAATTG
AAGAATTTGATCTAGTCCAAGGACTTGTCTTTCATCATGGAAGCTCACAACGGTTTATCC
GCTGCCATCGTTGAAGAAACTGGCTTCAAGGGTATCTGGGGTTCTGGTTTATCTATTTCT
GCTGCTATGGGTGTCAGAGATTCCAACGAAGCTTCCTACACTTAGGTTTTGGAAGTTTTG
GAATTCATGAGTGACAGAACCAAGATTCCCATCCTTTTGGACGGTGACACTGGTTACGGT
AACTACAACAACGCTAGAAGATTAGTTAAGAAATTAGAACAAAGAAATATTGGTGGTGTC
TGCTTAGAAGATAAGATTTTCCCCAAGAGAAACTCTCTTTTGGAAGGAGGAAGATAAGAA
TTAGCTCCCATCTAGGAATTCGCCAGCAAGATCAAGGCCTGCAAGGACACTCAATAAGAT
GCTGACTTCTAGGTTGTCGCTAGAGTTGAAGCCTTCATCGCTGGTTGGGGTTTAGAAGAA
GCCCTCAAGAGAGCTGAAGCTTACAGAGAAGCTGGTGCTGATGCCATCCTCATGCACTCC
AAGCTTAAAGAACCTTCTGAAATTGAAGCCTTCATGAAGGAATGGAAGAACAGAGCTCCC
GTTATTATTGTCCCCACTAACTACTACACCGTCCCCACTGATACCTTCAGAAAATGGGGT
GTCAATATGGTCATCTGGGCTAACCACAACATGAGAGCTTGTGTCTCCGCCATGTAAGAA
ACCTCCAGAAAAATCTACGAAGATGAATCTCTTGTCAACGTTGAAAACAAGGTTGCCAAG
GTTAAGGAAGTTTTCAGACTCCAAGGAGAAGATGAACTCAAGCAAGCTGATAAGAAGTAT
CTCTGA


>TTHERM_00022810(protein)
MLANSLKNFFSSAPRKTTQLKNLIQSKDLSFIMEAHNGLSAAIVEETGFKGIWGSGLSIS
AAMGVRDSNEASYTQVLEVLEFMSDRTKIPILLDGDTGYGNYNNARRLVKKLEQRNIGGV
CLEDKIFPKRNSLLEGGRQELAPIQEFASKIKACKDTQQDADFQVVARVEAFIAGWGLEE
ALKRAEAYREAGADAILMHSKLKEPSEIEAFMKEWKNRAPVIIVPTNYYTVPTDTFRKWG
VNMVIWANHNMRACVSAMQETSRKIYEDESLVNVENKVAKVKEVFRLQGEDELKQADKKY
L


>TTHERM_00022810(gene)
ATGTTGGCTAACAGTCTTAAGAACTTCTTCTCTTCTGCTCCCAGAAAGACCACCTAATTG
AAGAATTTGATCTAGTCCAAGGACTTGTCTTTCATCATGGAAGCTCACAACGGTTTATCC
GCTGCCATCGTTGAAGAAACTGGCTTCAAGGGTATCTGGGGTTCTGGTTTATCTATTTCT
GCTGCTATGGGTGTCAGAGATTCCAACGAAGCTTCCTACACTTAGGTAAATTTTACACAG
TCCTCTACATTTTTGAAAGATGACAGTCTCTTCTTTTATTATTTCTATGGCTATTTGAAA
ATTCCAAAAAAAAGTTCATTTTAGAACCATTTAGCATTTTATTTTAGACTGCTTTTTTAT
AAAATAGTCTAAACTCCTTAAGATACTAATTAGTTAACTAACAAGCTAGTTAAAAAAAAC
AAACAAAAAATATATGAAAATTATAAAACTATTTGAAAATGTTATTAATTTATTTAATTA
TTGTATAGGTTTTGGAAGTTTTGGAATTCATGAGTGACAGAACCAAGATTCCCATCCTTT
TGGACGGTGACACTGGTTACGGTAACTACAACAACGCTAGAAGATTAGTTAAGAAATTAG
AACAAAGAAATATTGGTGGTGTCTGCTTAGAAGATAAGATTTTCCCCAAGAGAAACTCTC
TTTTGGAAGGAGGAAGATAAGAATTAGCTCCCATCTAGGAATTCGCCAGCAAGATCAAGG
CCTGCAAGGACACTCAATAAGATGCTGACTTCTAGGTATTTATTTATTTATTTACTAAAT
TTTTATCTCCTCTTAACTATTATCAAAATATCCCCTTATTAATTTTATTTTTACTTCAAT
TTTATAGGTTGTCGCTAGAGTTGAAGCCTTCATCGCTGGTTGGGGTTTAGAAGAAGCCCT
CAAGAGAGCTGAAGCTTACAGAGAAGCTGGTGCTGATGCCATCCTCATGCACTCCAAGCT
TAAAGAACCTTCTGAAATTGAAGCCTTCATGAAGGTAAAAAAAACTATTCTAATAATAAA
AATCAATAACTCACTCATTAAGTTAATTAGCAAACAAAAAACAAAATTAAATATAACCAG
CTATTTTATTAGTAAATAAACAAACAAATCAATAAGCAAAGCAAAGAAAAATTTTTGTGT
AAATGAAAGCAAAAAAAAAAAAATAAGATTTTAAAAGAAATAGCAAGCAAATTTATAAAT
TTGATTTTAACAAATTAATTTATTTTATTCTGTTAAAATAAATTGTTTAGCCCAATCTTA
TTAACTCTTTTTTATTAATTAGGAATGGAAGAACAGAGCTCCCGTTATTATTGTCCCCAC
TAACTACTACACCGTCCCCACTGATACCTTCAGAAAATGGGGTGTCAATATGGTCATCTG
GGCTAACCACAACATGAGAGCTTGTGTCTCCGCCATGTAAGAAACCTCCAGAAAAATCTA
CGAAGATGAATCTCTTGTCAACGTTGAAAACAAGGTTGCCAAGGTTAAGGAAGTTTTCAG
ACTCCAAGGAGAAGATGAACTCAAGCAAGCTGATAAGAAGTATCTCTGA