Identifiers and Description

Gene Model Identifier

TTHERM_00022810

Standard Name

None

Aliases

PreTt11993 | 1.m01041

Description

Phosphoenolpyruvate phosphomutase precursor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR02317 ) methylisocitrate lyase
  • ( TIGR02321 ) phosphonopyruvate hydrolase
  • ( TIGR02320 ) phosphoenolpyruvate phosphomutase
  • ( TIGR02319 ) carboxyvinyl-carboxyphosphonate phosphorylmutase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13843.19.99709313703352e-262phosphoenolpyruvate phosph...
ParameciumDBGSPATP000221840019.99605028384712e-108Paramecium tetraurelia GSPATP0
0022184001 protein
OxytrichaContig13562.0.g17.00092464067569e-24Phosphoenolpyruvate phosphomut
ase
ToxoDB83.m000054.99924525917341e-21Toxoplasma gondii carboxyvinyl
-carboxyphosphonate phosphoryl
mutase, putative
TAIRAT1G214402.99851380290819e-19mutase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00022810(coding)
ATGTTGGCTAACAGTCTTAAGAACTTCTTCTCTTCTGCTCCCAGAAAGACCACCTAATTG
AAGAATTTGATCTAGTCCAAGGACTTGTCTTTCATCATGGAAGCTCACAACGGTTTATCC
GCTGCCATCGTTGAAGAAACTGGCTTCAAGGGTATCTGGGGTTCTGGTTTATCTATTTCT
GCTGCTATGGGTGTCAGAGATTCCAACGAAGCTTCCTACACTTAGGTTTTGGAAGTTTTG
GAATTCATGAGTGACAGAACCAAGATTCCCATCCTTTTGGACGGTGACACTGGTTACGGT
AACTACAACAACGCTAGAAGATTAGTTAAGAAATTAGAACAAAGAAATATTGGTGGTGTC
TGCTTAGAAGATAAGATTTTCCCCAAGAGAAACTCTCTTTTGGAAGGAGGAAGATAAGAA
TTAGCTCCCATCTAGGAATTCGCCAGCAAGATCAAGGCCTGCAAGGACACTCAATAAGAT
GCTGACTTCTAGGTTGTCGCTAGAGTTGAAGCCTTCATCGCTGGTTGGGGTTTAGAAGAA
GCCCTCAAGAGAGCTGAAGCTTACAGAGAAGCTGGTGCTGATGCCATCCTCATGCACTCC
AAGCTTAAAGAACCTTCTGAAATTGAAGCCTTCATGAAGGAATGGAAGAACAGAGCTCCC
GTTATTATTGTCCCCACTAACTACTACACCGTCCCCACTGATACCTTCAGAAAATGGGGT
GTCAATATGGTCATCTGGGCTAACCACAACATGAGAGCTTGTGTCTCCGCCATGTAAGAA
ACCTCCAGAAAAATCTACGAAGATGAATCTCTTGTCAACGTTGAAAACAAGGTTGCCAAG
GTTAAGGAAGTTTTCAGACTCCAAGGAGAAGATGAACTCAAGCAAGCTGATAAGAAGTAT
CTCTGA


>TTHERM_00022810(protein)
MLANSLKNFFSSAPRKTTQLKNLIQSKDLSFIMEAHNGLSAAIVEETGFKGIWGSGLSIS
AAMGVRDSNEASYTQVLEVLEFMSDRTKIPILLDGDTGYGNYNNARRLVKKLEQRNIGGV
CLEDKIFPKRNSLLEGGRQELAPIQEFASKIKACKDTQQDADFQVVARVEAFIAGWGLEE
ALKRAEAYREAGADAILMHSKLKEPSEIEAFMKEWKNRAPVIIVPTNYYTVPTDTFRKWG
VNMVIWANHNMRACVSAMQETSRKIYEDESLVNVENKVAKVKEVFRLQGEDELKQADKKY
L


>TTHERM_00022810(gene)
AAAATAAACAAATAATCTTTAAATTAATTAAAAAAAATATCTAGCAAAACAAACAAATAA
ATAAATATCTAAAATGTTGGCTAACAGTCTTAAGAACTTCTTCTCTTCTGCTCCCAGAAA
GACCACCTAATTGAAGAATTTGATCTAGTCCAAGGACTTGTCTTTCATCATGGAAGCTCA
CAACGGTTTATCCGCTGCCATCGTTGAAGAAACTGGCTTCAAGGGTATCTGGGGTTCTGG
TTTATCTATTTCTGCTGCTATGGGTGTCAGAGATTCCAACGAAGCTTCCTACACTTAGGT
AAATTTTACACAGTCCTCTACATTTTTGAAAGATGACAGTCTCTTCTTTTATTATTTCTA
TGGCTATTTGAAAATTCCAAAAAAAAGTTCATTTTAGAACCATTTAGCATTTTATTTTAG
ACTGCTTTTTTATAAAATAGTCTAAACTCCTTAAGATACTAATTAGTTAACTAACAAGCT
AGTTAAAAAAAACAAACAAAAAATATATGAAAATTATAAAACTATTTGAAAATGTTATTA
ATTTATTTAATTATTGTATAGGTTTTGGAAGTTTTGGAATTCATGAGTGACAGAACCAAG
ATTCCCATCCTTTTGGACGGTGACACTGGTTACGGTAACTACAACAACGCTAGAAGATTA
GTTAAGAAATTAGAACAAAGAAATATTGGTGGTGTCTGCTTAGAAGATAAGATTTTCCCC
AAGAGAAACTCTCTTTTGGAAGGAGGAAGATAAGAATTAGCTCCCATCTAGGAATTCGCC
AGCAAGATCAAGGCCTGCAAGGACACTCAATAAGATGCTGACTTCTAGGTATTTATTTAT
TTATTTACTAAATTTTTATCTCCTCTTAACTATTATCAAAATATCCCCTTATTAATTTTA
TTTTTACTTCAATTTTATAGGTTGTCGCTAGAGTTGAAGCCTTCATCGCTGGTTGGGGTT
TAGAAGAAGCCCTCAAGAGAGCTGAAGCTTACAGAGAAGCTGGTGCTGATGCCATCCTCA
TGCACTCCAAGCTTAAAGAACCTTCTGAAATTGAAGCCTTCATGAAGGTAAAAAAAACTA
TTCTAATAATAAAAATCAATAACTCACTCATTAAGTTAATTAGCAAACAAAAAACAAAAT
TAAATATAACCAGCTATTTTATTAGTAAATAAACAAACAAATCAATAAGCAAAGCAAAGA
AAAATTTTTGTGTAAATGAAAGCAAAAAAAAAAAAATAAGATTTTAAAAGAAATAGCAAG
CAAATTTATAAATTTGATTTTAACAAATTAATTTATTTTATTCTGTTAAAATAAATTGTT
TAGCCCAATCTTATTAACTCTTTTTTATTAATTAGGAATGGAAGAACAGAGCTCCCGTTA
TTATTGTCCCCACTAACTACTACACCGTCCCCACTGATACCTTCAGAAAATGGGGTGTCA
ATATGGTCATCTGGGCTAACCACAACATGAGAGCTTGTGTCTCCGCCATGTAAGAAACCT
CCAGAAAAATCTACGAAGATGAATCTCTTGTCAACGTTGAAAACAAGGTTGCCAAGGTTA
AGGAAGTTTTCAGACTCCAAGGAGAAGATGAACTCAAGCAAGCTGATAAGAAGTATCTCT
GAGAATCTAATTTTTCCAATAAACTAACATATACACTTTTTAAAATATGATGGCTTTATG
AGTAAAACAATAAACAATAAAACAAAGTGAATTCAGTTTTAGGATTTCTAAATAAAGTTA
AGAATATAAATAGTAATTTATTGATTGATTGGTAAAGCATTTGTTGATTAATTAATTAAT
AGTTAATAGTTCTATTTATCAAAATTCCCACAATTAACTAATTAGTTGATTCATGCTAAT
AATAATTTATTTAATGCTTAGTTTGCTATCTCTTAAAAATATAAGCATTCACTCATTACT
AACTAAATTAATTCGACTTATTAAAATATATTTATATAATGCTGCTTATTTATTATTCAT
TAATCTATGTGTATTCTAAACTTTACTCTTAAAATAAA