Identifiers and Description

Gene Model Identifier

TTHERM_000161459

Standard Name

None

Aliases

None

Description

glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.7%

TetraMine Data

TTHERM_000161459

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05398.16.002964263484389e-144hypothetical protein (229 aa)
OxytrichaContig10677.0.g592.000704504372864e-47Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02877939.999888128184441e-42DDB_G0287793 on chromosome: 5
position 710171 to 710938
Stentor CoeruleusSteCoe_357391.2995814250075031e-24
WormBaseWBGene000017900.00000030014504373857585locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000161459(coding)
ATGTAAGATTAACAACAAACCCTAAGTCTTTATATGGACTGGATGTCTTAGCCTTCTAGA
TGCGTTGCAATTTTTTGCATGATAAATAAAATCCCTGTTGATATCTCAGAGGTAAAAATT
CTCAAAGGATAGCTCAGAAGTCAAGAATACAAAAGAATCAATCCTAATATGAGAGTTCCT
ACTATTAAAGACGGTAAATTCGTGCTTTATGAGTCTCATGCAATACTTAAATATTTGATA
GCTTCAAGGGCATAATATATTCCTGAACATTGGTATCCTAAGGATATAAAAGAACGTGCA
TTAGTAGATTAATATTTAGACTGGCACCACACAAATATCAGAAACGCAGGAATGTATATT
TTCAACTACTTTGTGCTTCCAAGTTTAGGTATTTAGTCTAAGTAGAATAAAGAAACTATT
TACAAATTGTTTATCTAATCCTTGAAAATGATTGATACAATATTTTTAGCTGATAAGCCA
TATATTGCTTCAAAGGAAAAAGCAACTATCGCTGATCTCTCCTGCTATTGCGAAATTACC
TAAGTTAATTTAATTGATTTTGATTTCTCTCCTTATCCTAACATTCTTAAGTGGATGTAA
AGACTTACTGCTGAATATCCATAGCTAGTTGAAGGACATCAACCTTTTATGAAATTTGTT
TAGAAGATTAAAGAAAAATAAAATTTATGA


>TTHERM_000161459(protein)
MQDQQQTLSLYMDWMSQPSRCVAIFCMINKIPVDISEVKILKGQLRSQEYKRINPNMRVP
TIKDGKFVLYESHAILKYLIASRAQYIPEHWYPKDIKERALVDQYLDWHHTNIRNAGMYI
FNYFVLPSLGIQSKQNKETIYKLFIQSLKMIDTIFLADKPYIASKEKATIADLSCYCEIT
QVNLIDFDFSPYPNILKWMQRLTAEYPQLVEGHQPFMKFVQKIKEKQNL


>TTHERM_000161459(gene)
ATGTAAGATTAACAACAAACCCTAAGTCTTTATATGGACTGGATGTCTTAGCCTTCTAGA
TGCGTTGCAATTTTTTGCATGATAAATAAAATCCCTGTTGATATCTCAGAGGTAAAAATT
CTCAAAGGATAGCTCAGAAGTCAAGAATACAAAAGAATCAATCCTAATATGAGAGTTCCT
ACTATTAAAGACGGTAAATTCGTGCTTTATGAGTCTCATGCAATACTTAAATATTTGATA
GCTTCAAGGGCATAATATATTCCTGAACATTGGTATCCTAAGGATATAAAAGAACGTGCA
TTAGTAGATTAATATTTAGACTGGCACCACACAAATATCAGAAACGCAGGAATGTATATT
TTCAACTACTTTGTGCTTCCAAGTTTAGGTATTTAGTCTAAGTAGAATAAAGAAACTATT
TACAAATTGTTTATCTAATCCTTGAAAATGATTGATACAATATTTTTAGCTGATAAGCCA
TATATTGCTTCAAAGGAAAAAGCAACTATCGCTGATCTCTCCTGCTATTGCGAAATTACC
TAAGTTAATTTAATTGATTTTGATTTCTCTCCTTATCCTAACATTCTTAAGTGGATGTAA
AGACTTACTGCTGAATATCCATAGCTAGTTGAAGGACATCAACCTTTTATGAAATTTGTT
TAGAAGATTAAAGAAAAATAAAATTTATGA