Identifiers and Description

Gene Model Identifier

TTHERM_00013790

Standard Name

None

Aliases

PreTt11885 | 1.m00933

Description

PSP family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00013790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02664.19.997093137033517e-262PSP family protein (521 aa)
OxytrichaContig22799.0.g832.0007889996237956e-71Domain of unknown function (DU
F382)
DictyBaseDDB_G02845553.998648822114894e-70sf3b2 on chromosome: 4 positio
n 2068357 to 2070234
WormBaseWBGene000210044.001287313050914e-66status:Confirmed UniProt:O16
997 protein_id:CCD74282.1
SGDYMR240C1.999002769139511e-37CUS1 Protein required for asse
mbly of U2 snRNP into the spli
ceosome, forms a complex with
Hsh49p and Hsh155p
Stentor CoeruleusSteCoe_363987.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00013790(coding)
ATGACAAAGGAGGAGAGGGAAAAGCTCCATAGATTAAAAAAAAAGAAATAGTAGAAGCAG
AAGAAGAAAGAGGAAAGATCAAATCAAAGTAATGTTTAAAGTGAATCTTCATTTGACTCA
GTTTCTGTGCAGACTGAAGTCTCAGATAACACTCTCGCACGTCTTTCTCATTAAAATCAA
AATAATATTGCTAATAGTGAAATGCACTCTAATGATAATATTGAAGATGTAGAATATGTT
TATGAAAGTGAGGACAACGTTTTAACTGGATAATATTATGAATTATTTAAAGATGTGTTT
AAAAAATACTCAGAGAAGTAAGTTAGCGCTTAAGAGTAATAAGAAATCGAAGAAGAAAAG
AATGAAGAGGAGTAAAAGAAATTGTAAGAAGAATATGAAGAGAAAAAAGCTAAAAGAGCT
TAAGAAAAGCTTGAAAAAGAGTAAAACAAGGAGAAATTATCACGTAAATAGCGTAAATAA
TAGAGATGGTTGCAAGTTGCATAGCTTAAGGCTCTCGTAAAGAGACCTGATTTAGTAGAA
GCATGGGATATTACTGCACCTGATCCAAGAACCTTAGTTTTTTTAAAATCTTTAAAAAAT
ACTGTCCCTGTGCCTCGTCACTGGTGCCAAAAGAGAAAATATCTTTAAAACAAGCGTGGT
ATTTTGAAATAACCCTTTAAATTGCCAGAATATATTGAAAACACTGGTATTGCCAAATTA
AGAGATCCTTTCTCTGAAAGAGACGGTATAACAATGGTTAAATAAAAGCTAAAAGAACGT
ATGAATCCTAAAATGGGTAAAATTGAAATTGATTATGATGTACTTCACGATGCTTTCTTC
AAATATCAAACTAAACCCAAGCTTACCATTCATGGTGATATCTATTACGAAGGAAAAGAA
GATGAGTGTCAATCTAAGAAGTATAAGCCTGGAAGAATGAGTGAAGCATTGAGATCAGCT
TTAGAAATATCAGATTACGCTCCTCCACCTTGGTTGGCTAGTATGCAACGTTACGGTCCA
CCTCCATCTTATCCAAACTTGAAAATTATTGGTATGACTTATCATGACTAAGGAGGAAGC
TTTTTAAATAAAGTTGCTATTGAGGAATAGGTAAAGTAAATGAATATGCCTGGTATCTAT
GGTATTTTTAAATCAGATGATGATGGGAATGATGATGCCATTCCAGTGCCTAAAGGATAT
TGGGGACAAGTCATTGAAGATGATGACCATAATGTAGAAGACTAAGCTGAAGTTGTTGAG
GATTAAGACTTAGATGAAGATGACTTAGGAGACGATGATGTAGACTTCGAAGAATAACTC
TAATCCTACGATAAATAAGGTGGACAATAATAAAATTATCCCAAACATGCGGCAGTCAAT
CAATCAAATGCTGCTGGCTTTGAGACACCTGATGTAGATATTAGAGGATAACCTGCTTCA
GAGGCTCCTCTTTATCATGTGCTAGAACAAGTTCCAACAAAAGGATAATCTGGAGCTATA
TTAGGAAGCTAACACACTTATATAATGCATGGCTAGCATTAAAATTGA


>TTHERM_00013790(protein)
MTKEEREKLHRLKKKKQQKQKKKEERSNQSNVQSESSFDSVSVQTEVSDNTLARLSHQNQ
NNIANSEMHSNDNIEDVEYVYESEDNVLTGQYYELFKDVFKKYSEKQVSAQEQQEIEEEK
NEEEQKKLQEEYEEKKAKRAQEKLEKEQNKEKLSRKQRKQQRWLQVAQLKALVKRPDLVE
AWDITAPDPRTLVFLKSLKNTVPVPRHWCQKRKYLQNKRGILKQPFKLPEYIENTGIAKL
RDPFSERDGITMVKQKLKERMNPKMGKIEIDYDVLHDAFFKYQTKPKLTIHGDIYYEGKE
DECQSKKYKPGRMSEALRSALEISDYAPPPWLASMQRYGPPPSYPNLKIIGMTYHDQGGS
FLNKVAIEEQVKQMNMPGIYGIFKSDDDGNDDAIPVPKGYWGQVIEDDDHNVEDQAEVVE
DQDLDEDDLGDDDVDFEEQLQSYDKQGGQQQNYPKHAAVNQSNAAGFETPDVDIRGQPAS
EAPLYHVLEQVPTKGQSGAILGSQHTYIMHGQHQN


>TTHERM_00013790(gene)
ATGACAAAGGAGGAGAGGGAAAAGCTCCATAGATTAAAAAAAAAGAAATAGTAGAAGCAG
AAGAAGAAAGAGGAAAGATCAAATCAAAGTAATGTTTAAAGTGAATCTTCATTTGACTCA
GTTTCTGTGCAGACTGAAGTCTCAGATAACACTCTCGCACGTCTTTCTCATTAAAATCAA
AATAATATTGCTAATAGTGAAATGCACTCTAATGATAATATTGAAGATGTAGAATATGTT
TATGAAAGTGAGGACAACGTTTTAACTGGATAATATTATGAATTATTTAAAGATGTGTTT
AAAAAATACTCAGAGAAGTAAGTTAGCGCTTAAGAGTAATAAGAAATCGAAGAAGAAAAG
AATGAAGAGGAGTAAAAGAAATTGTAAGAAGAATATGAAGAGAAAAAAGCTAAAAGAGCT
TAAGAAAAGCTTGAAAAAGAGTAAAACAAGGAGAAATTATCACGTAAATAGCGTAAATAA
TAGAGATGGTTGCAAGTTGCATAGCTTAAGGCTCTCGTAAAGAGACCTGATTTAGTAGAA
GCATGGGATATTACTGCACCTGATCCAAGAACCTTAGTTTTTTTAAAATCTTTAAAAAAT
ACTGTCCCTGTGCCTCGTCACTGGTGCCAAAAGAGAAAATATCTTTAAAACAAGCGTGGT
ATTTTGAAATAACCCTTTAAATTGCCAGAATATATTGAAAACACTGGTATTGCCAAATTA
AGAGATCCTTTCTCTGAAAGAGACGGTATAACAATGGTTAAATAAAAGCTAAAAGAACGT
ATGAATCCTAAAATGGGTAAAATTGAAATTGATTATGATGTACTTCACGATGCTTTCTTC
AAATATCAAACTAAACCCAAGCTTACCATTCATGGTGATATCTATTACGAAGGAAAAGAA
GATGAGTGTCAATCTAAGAAGGTAAAATTATTTATAAATTAAAAATAAAATATTTAATTG
AATAAAATTATTTCTACTCTTTTCATTCAAAAATTAATTATAAAATCTATTTTATTTGGT
ATATTGTAAATAATCTTTTTATTTGATAATTAATTATTGATAGTATAAGCCTGGAAGAAT
GAGTGAAGCATTGAGATCAGCTTTAGAAATATCAGATTACGCTCCTCCACCTTGGTTGGC
TAGTATGCAACGTTACGGTCCACCTCCATCTTATCCAAACTTGAAAATTATTGGTAAAAT
TTATTGAAAGAATTTTATAAAAATTTATTAAAAAAAATGAAAATAAATATAAAGGTATGA
CTTATCATGACTAAGGAGGAAGCTTTTTAAATAAAGTTGCTATTGAGGAATAGGTAAAGT
AAATGAATATGCCTGGTATCTATGGTATTTTTAAATCAGATGATGATGGGAATGATGATG
CCATTCCAGTGCCTAAAGGATATTGGGGACAAGTCATTGAAGATGATGACCATAATGTAG
AAGACTAAGCTGAAGTTGTTGAGGATTAAGACTTAGATGAAGATGACTTAGGAGACGATG
ATGTAGACTTCGAAGAATAACTCTAATCCTACGATAAATAAGGTGGACAATAATAAAATT
ATCCCAAACATGCGGCAGTCAATCAATCAAATGCTGCTGGCTTTGAGACACCTGATGTAG
ATATTAGAGGATAACCTGCTTCAGAGGCTCCTCTTTATCATGTGCTAGAACAAGTTCCAA
CAAAAGGATAATCTGGAGCTATATTAGGAAGCTAACACACTTATATAATGCATGGCTAGC
ATTAAAATTGA