Identifiers and Description

Gene Model Identifier

TTHERM_00013760

Standard Name

None

Aliases

PreTt11882 | 1.m00930

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02524 ) KID repeat
  • ( PF01576 ) Myosin tail
  • ( PF01920 ) Prefoldin subunit
  • ( PF04949 ) Family of unknown function (DUF662)
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00013760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02676.19.997093137033517e-262hypothetical protein (931 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00013760(coding)
ATGTCTCAACAGCAACTCAATTATAATAGCAACCATCCTGTGTATTCTCACTAGATTATA
TAAGGAGCCCCACAAATCACTAATAGTTACAGTGTTGGCGCTGAAAAGAGATACAGTGAA
AAGTTTACCTCTGGCACAAGTAATGCCGTGCATGGAGCTTCTCGCTTTGCTGTTAATTCC
CCAGCCATTCGTACTCCTAAAAACTAGAAAATAGTCTACATTACTAATAACGAATAGTAG
CAAGCTGTGCAAGGTTAGGCAGTTATTGGAGGTCACTAGATCGTATAAGGTCATCAAAAG
TTAGTATCTGGAACACAATTAATTTAAGGCTCTTAGTTAATTGGAGGATAGGCAGTTTAA
TAAGTTATACACCCCTAGTAAATTGTTTCTGGTCCCATCATCACCACAAGATAAAGTGCT
GTTTACCAATAAGTTGAATAGGTTCCTTAAATCATCACTACAACTGTTCCTTCTTAATCT
TAATTAATCAGTTAGCAATAGGCTAATTTACTTGTTAGCAACTCTCCTTCTCATATTTAG
GTTGTGAAAAGTGTTGTTTAAACTCCTCCATCCGTCATTCACACAAAGCAAGTTATCTCT
GCCTCTCCTGTAGTCCATACTACAAGTGAAATCATTAAAAGTACCTAAAATGTCTCATAT
TCATCAAATGATGAGCTCTTAATCAAAGAATTAGAAGGCTATAAGAAAAAATGTGCTCAC
TTGGAAACACATATCTTGGAGTACAAATAAAAGTTTGAAGTGATCAGAATTACAGAGAGT
TAGTTAACTGAAGTACTTACTGAAAACAGAAATTTAGCACAACAAATAAATGAATATTTG
ATGCAAATAACACAATACAGATAACAAATAGAATAGTTGAAGTTGCGTTTGAATTAAACA
GCAATCTTTGAGCAAGAGTACAAAAAAATATAAGATATTTACAATTAGTAACTTATCTTG
ATTGAATAGATGAAAAACGAGCTTATCATGAAAAGCAACAAAATTCAAGAGCTTCTCCAC
AAGGATGAAGAAAATCAAAGAATAATTTAAAATTTAATGAATTAGCTCTAAGGCATGCAA
GATCAGAACGATGAAATCGTTAAGAGATCTAAGAGAGATAAAGATAATAAAGATAAAGAA
TATTAGGATAAGATAGATGCATTAAATTAAAAACTTGCAGATAAAGAAAAGGAATTGCAA
AACATTCTCTTTGCTCTCTCTAATTCTGAAAATTCTAAATACCAAGGAGATCTTTAGCTT
AAAAATTTACAAGATAACATAGCATATCTTCAAATTGAAATTAAGAATAAAGACGAAACA
GTCAAAGCTAAAAATGCTGAAATTGACAGGTTGAGAGAATAGCTCAATAACTTGCAAATT
AATATTTACTAATTGTAAAATGTAGAATAGGAAAAGCAAAGATTATAGCAAGTTATAGAA
AATAAGAATTAAGAAATTGAATAGTGGAAGAAATCATATGCTGATTAAGATTAGAAGATA
AACGAACTCAGAAGTCAAGTTACAAACATTTATGTTTTGTAGAACTAAATTTAGAATTTG
TAACGCGAGAATGAAGGTTTAAGAAACATGATTGATCAAAAGGAAGATGATGTCAAGCGC
TCTAAAAAACGTGAAAAGGAACTTGAAAAGGAATCAGATGATAAAAAGGTTCTTCTTTAC
GAGAAATCTCAATATGAAGCTAAATTGTAATTGCTTACAAATGAAATCGAAAATCTCACA
CGCACTTTATAATAAAAATAAACTGAAAATGAAGATTTGAGATTAAAGATTACTCAAATT
CAAAGCTAAGTTTATTTGCTTCAACATAACGAAACAGTTGTAATTAACTTGAACACTTAA
ATTACCAACCTTGAAAATGATTTAAAAGCTGCAAGAGAATTAGCTCAAAAACTTGAGTAT
GAAACCATCTCACTAAAGAGCCAAATTGCCGAAAGAGACTACAAGATTTAAGGCTTAACC
TAAGAAATAAATAACTTAAAGAGCATTTCCAACGAATACAATCAAGTCAGACAATCTGTA
AATGAAACTGAATTGAAAGTGATAACTTTGAACTAAACCATTAACAAGCTTAATCTTACA
ATCCAACAAAAGGATCATGAAATTGAATACTACAGAAATGCTAACAAGAATCTGGCTGAA
GATAACGAAAAAATGAAGAAACTTATTGCTGAATTACAAATTATTGTTCATTAGTTAGAA
ATAACATTAAAAGAAACTAACATTTAGCTTAATATTTATAAAGAAACTCAAAATACTAAC
TTAAGTCTTTATAGCTAGATTGACTAATTGAAGAAATAATTGAATGAATCTGAATTAAGA
TATGAAGAACTCCTTAAGAAGTATAACTTTGAAAAAGAGCAATATGAAAATAGGTTAGTC
CTATTATCTACTGAGACTTAAAGAAAGGATTTCATGATCAACTCTAAAAACTAAGAAATT
GAATAACTGAGAACTCAACTCATTTCTTACACAGAAATTCAAATCTAGTACAAGTCTACT
CAAGACAGAATCCAATATCTTTTATAAGAAATCGATAGATTAACTGCTGACAACTAAGCC
TTGGCTAAAGAACTTGAAATTGTAAGATTAAGGTATGCCTAATACGCTGTCCTTGAATTA
TAAATTTAAGATTTGCTCATGAGAATAGTTTTACAAAGCGCAGAAGTTGAGAGTCTTAGA
TCTTTGGTTAACCAAAACAAATAAGAAAATAACTCTTTAAGATAATCTTAACTTAATGTC
TACAGATACTGA


>TTHERM_00013760(protein)
MSQQQLNYNSNHPVYSHQIIQGAPQITNSYSVGAEKRYSEKFTSGTSNAVHGASRFAVNS
PAIRTPKNQKIVYITNNEQQQAVQGQAVIGGHQIVQGHQKLVSGTQLIQGSQLIGGQAVQ
QVIHPQQIVSGPIITTRQSAVYQQVEQVPQIITTTVPSQSQLISQQQANLLVSNSPSHIQ
VVKSVVQTPPSVIHTKQVISASPVVHTTSEIIKSTQNVSYSSNDELLIKELEGYKKKCAH
LETHILEYKQKFEVIRITESQLTEVLTENRNLAQQINEYLMQITQYRQQIEQLKLRLNQT
AIFEQEYKKIQDIYNQQLILIEQMKNELIMKSNKIQELLHKDEENQRIIQNLMNQLQGMQ
DQNDEIVKRSKRDKDNKDKEYQDKIDALNQKLADKEKELQNILFALSNSENSKYQGDLQL
KNLQDNIAYLQIEIKNKDETVKAKNAEIDRLREQLNNLQINIYQLQNVEQEKQRLQQVIE
NKNQEIEQWKKSYADQDQKINELRSQVTNIYVLQNQIQNLQRENEGLRNMIDQKEDDVKR
SKKREKELEKESDDKKVLLYEKSQYEAKLQLLTNEIENLTRTLQQKQTENEDLRLKITQI
QSQVYLLQHNETVVINLNTQITNLENDLKAARELAQKLEYETISLKSQIAERDYKIQGLT
QEINNLKSISNEYNQVRQSVNETELKVITLNQTINKLNLTIQQKDHEIEYYRNANKNLAE
DNEKMKKLIAELQIIVHQLEITLKETNIQLNIYKETQNTNLSLYSQIDQLKKQLNESELR
YEELLKKYNFEKEQYENRLVLLSTETQRKDFMINSKNQEIEQLRTQLISYTEIQIQYKST
QDRIQYLLQEIDRLTADNQALAKELEIVRLRYAQYAVLELQIQDLLMRIVLQSAEVESLR
SLVNQNKQENNSLRQSQLNVYRY


>TTHERM_00013760(gene)
ATGTCTCAACAGCAACTCAATTATAATAGCAACCATCCTGTGTATTCTCACTAGATTATA
TAAGGAGCCCCACAAATCACTAATAGTTACAGTGTTGGCGCTGAAAAGAGATACAGTGAA
AAGTTTACCTCTGGCACAAGTAATGCCGTGCATGGAGCTTCTCGCTTTGCTGTTAATTCC
CCAGCCATTCGTACTCCTAAAAACTAGAAAATAGTCTACATTACTAATAACGAATAGTAG
CAAGCTGTGCAAGGTTAGGCAGTTATTGGAGGTCACTAGATCGTATAAGGTCATCAAAAG
TTAGTATCTGGAACACAATTAATTTAAGGCTCTTAGTTAATTGGAGGATAGGCAGTTTAA
TAAGTTATACACCCCTAGTAAATTGTTTCTGGTCCCATCATCACCACAAGATAAAGTGCT
GTTTACCAATAAGTTGAATAGGTTCCTTAAATCATCACTACAACTGTTCCTTCTTAATCT
TAATTAATCAGTTAGCAATAGGCTAATTTACTTGTTAGCAACTCTCCTTCTCATATTTAG
GTTGTGAAAAGTGTTGTTTAAACTCCTCCATCCGTCATTCACACAAAGCAAGTTATCTCT
GCCTCTCCTGTAGTCCATACTACAAGTGAAATCATTAAAAGTACCTAAAATGTCTCATAT
TCATCAAATGATGAGCTCTTAATCAAAGAATTAGAAGGCTATAAGAAAAAATGTGCTCAC
TTGGTAATTTGATTTTTATTATTAAATAATTCTTAGACATCAGAGCGATATTTATAAGCT
ATTGCTTTTCCTTATGTTTTTTGAAAATCATTTTTTAGCTTTAAAAAAAGCATTTTTAAA
AAATTGTCGTTTTTTTTTCTAAAAAGAGTTTTTCAATTTCTTCAAAAAAAATGAATTTTA
GAAAATTGATTGAGCAAGTCAAAATAAAAAGCATTCCTTAAAATTACTTTGTTGAAAAAA
AGCCATCAATTGTTAATCAATTGAATTGGTTTTCTTAAAAAGTAAATTTAAGATAAAGTG
CTTTATTAGATTTATCCCTATTTTGATTGAGGAAATGCAATAGAAATTATTGAATTAAGT
AGAATTTATTTCATGATTTTTAATTATATAAAGGAAACACATATCTTGGAGTACAAATAA
AAGTTTGAAGTGATCAGAATTACAGAGAGTTAGTTAACTGAAGTACTTACTGAAAACAGA
AATTTAGCACAACAAATAAATGAATATTTGATGCAAATAACACAATACAGATAACAAATA
GAATAGTTGAAGTTGCGTTTGAATTAAACAGCAATCTTTGAGCAAGAGTACAAAAAAATA
TAAGATATTTACAATTAGTAACTTATCTTGATTGAATAGATGAAAAACGAGCTTATCATG
AAAAGCAACAAAATTCAAGAGCTTCTCCACAAGTAAGAAATTTAATTTGCATTTTTTACT
TTAGTAAAAGCAATGTGAAGAAAATAAATAAATTATCTATTTTTTCATTTATTAAATAGG
GATGAAGAAAATCAAAGAATAATTTAAAATTTAATGAATTAGCTCTAAGGCATGCAAGAT
CAGAACGATGAAATCGTTAAGAGATCTAAGAGAGATAAAGATAATAAAGATAAAGAATAT
TAGGATAAGATAGATGCATTAAATTAAAAACTTGCAGATAAAGAAAAGGAATTGCAAAAC
ATTCTCTTTGCTCTCTCTAATTCTGAAAATTCTAAATACCAAGGAGATCTTTAGCTTAAA
AATTTACAAGATAACATAGCATATCTTCAAATTGAAATTAAGAATAAAGACGAAACAGTC
AAAGCTAAAAATGCTGAAATTGACAGGTAATAAATAAATAAACAAACAAACAAATAATAA
TAATTTTTATCTCAAAATCAACTTTTATGCCTAAGCATACATTTTTTCATTTGTAAAATA
TTGAATTATTTTTCTATCGTCACTAAATATTCTATTGATATAATGCCATAGATTGATTCT
ATTTTGAAAATTATTCATGTTTGACTATCAAATACATTGTATTAACAGAAGATAGCAGTA
TTAATATTAATCAGATAATATTTAGTATTTAATTAGCTTAAAGACTATTTTATAGTTGAT
AAGCCAAACCTCTTAGTTTTTAGTGTTTAGCTCAAAATTTGCATTAAATATAAGCTTTTT
GCATGATAAAGTATTAATAGAGTTTTGTTTAAAAAAAAATAGGTTGAGAGAATAGCTCAA
TAACTTGCAAATTAATATTTACTAATTGTAAAATGTAGAATAGGAAAAGCAAAGATTATA
GCAAGTTATAGAAAATAAGAATTAAGAAATTGAATAGTGGAAGAAATCATATGCTGATTA
AGATTAGAAGATAAACGAACTCAGAAGTCAAGTTACAAACATTTATGTTTTGTAGAACTA
AATTTAGAATTTGTAACGCGAGAATGAAGGTTTAAGAAACATGATTGATCAAAAGGAAGA
TGATGTCAAGCGCTCTAAAAAACGTGAAAAGGAACTTGAAAAGGAATCAGATGATAAAAA
GGTTCTTCTTTACGAGAAATCTCAATATGAAGCTAAATTGTAATTGCTTACAAATGAAAT
CGAAAATCTCACACGCACTTTATAATAAAAATAAACTGAAAATGAAGATTTGAGATTAAA
GATTACTCAAATTCAAAGCTAAGTTTATTTGCTTCAACATAACGAAACAGTTGTAATTAA
CTTGAACACTTAAATTACCAACCTTGAAAATGATTTAAAAGCTGCAAGAGAATTAGCTCA
AAAACTTGAGTATGAAACCATCTCACTAAAGAGCCAAATTGCCGAAAGAGACTACAAGAT
TTAAGGCTTAACCTAAGAAATAAATAACTTAAAGAGCATTTCCAACGAATACAATCAAGT
CAGACAATCTGTAAATGAAACTGAATTGAAAGTGATAACTTTGAACTAAACCATTAACAA
GCTTAATCTTACAATCCAACAAAAGGTAATTTTTATTTTCTATTATTAAAAACGAATTTC
AGTAAATATTTAACAAAATTATAAAAAAAATACCATAATTATAAAGCAAGCACATTCAGC
AATCAAATAACAAAATAAATTTATTTGTGCAAAACAAACTATGTAAAAAAGCTACAAGCA
AAAATAAAATAAATAAACAAATAAAATCTAAAAAAACTAAATTTTATAATTTTGATTACA
AAAATAAAAAAAATCGTCTCCTATTTAAATTAACACCAAATTAAAAATAATTTACACAAA
ATTAAATTAACAAGGCATTAAGATAATCTAAATAGAATTATTGTTTAAATGAATATTGCC
TAAATAAATTTTTAAAAAATTTTATCAGATAAACATCTTTATTAAAATGAAAATTGAAAG
TTTTGAATTTTATTAATTTTATTAATTTTTAGATAAAAAAAATATAAATAAATTTAAATA
AAAGGATCATGAAATTGAATACTACAGAAATGCTAACAAGAATCTGGCTGAAGATAACGA
AAAAATGAAGAAACTTATTGCTGAATTACAAATTATTGTTCATTAGTTAGAAATAACATT
AAAAGAAACTAACATTTAGCTTAATATTTATAAAGAAACTCAAAATACTAACTTAAGTCT
TTATAGCTAGATTGACTAATTGAAGAAATAATTGAATGAATCTGAATTAAGATATGAAGA
ACTCCTTAAGAAGTATAACTTTGAAAAAGAGCAATATGAAAATAGGTTAGTCCTATTATC
TACTGAGACTTAAAGAAAGGATTTCATGATCAACTCTAAAAACTAAGAAATTGAATAACT
GAGAACTCAACTCATTTCTTACACAGAAATTCAAATCTAGTACAAGTCTACTCAAGACAG
AATCCAATATCTTTTATAAGAAATCGATAGATTAACTGCTGACAACTAAGCCTTGGCTAA
AGAACTTGAAATTGTAAGATTAAGGTATGCCTAATACGCTGTCCTTGAATTATAAATTTA
AGATTTGCTCATGAGAATAGTTTTACAAAGCGCAGAAGTTGAGAGTCTTAGATCTTTGGT
TAACCAAAACAAATAAGAAAATAACTCTTTAAGATAATCTTAACTTAATGTCTACAGATA
CTGA