Identifiers and Description

Gene Model Identifier

TTHERM_00013480

Standard Name

None

Aliases

PreTt11854 | 1.m00902

Description

hypothetical protein; ADL128Cp-related

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08767 ) CRM1 C terminal
  • ( PF08480 ) Disaggregatase related
  • ( PF08389 ) Exportin 1-like protein
  • ( PF08638 ) Mediator complex subunit MED14
  • ( PF03810 ) Importin-beta N-terminal domain
  • ( TIGR01492 ) Plasmodium falciparum CPW-WPC domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00013480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_135520
Tetrahymena borealisEI9_02696.19.997093137033517e-262hypothetical protein (1110 aa)
DictyBaseDDB_G02913069.997093137033517e-262xpo1 on chromosome: 6 position
102439 to 105968
OxytrichaContig10697.0.g519.997093137033517e-262CRM1 C terminal
SGDYGR218W9.997093137033517e-262CRM1 Major karyopherin, involv
ed in export of proteins, RNAs
, and ribosomal subunits from
the nucleus; exportin
WormBaseWBGene000020783.000071119766155e-172locus:xpo-1 status:Confirmed
UniProt:Q23089 protein_id
:CCD65776.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00013480(coding)
ATGATGTAAAACTATCCTCCTGAAATATAAAGTCTTTTCCAATCTTAAAAGCTTGATTAG
CAAAAGGTGCAAATCCTTGACTAGGTTACAAAGCTGATGGCATGTGGTGATAATTAAAAG
ATGCAGATGGCTCAGCAAGTTTGGAAAGACCTTAAAGAGAACACTGAATTTTGGGTCAAT
GTAGATATTGTTTTAGAGACTTCTAGCGATTATCAAACTAAAATTCTTACTTTAGTATTG
ATGGAAGATACTATCAAGTAAAAATGGTAAGCTCTCCCTCAACAAACCCAAGAAAATTTA
AAGAACTACATCTTAGCTTTTGTATTTAGGTAAAGTCAATAGCCTAATCCCACTAGAGAT
TCATTAACACTATTAAATAAATGCAACTCTATAATCATTTAAATTTTAAAATTTGAATGG
AATTCTACATGGAAGAACTTTATCCCTGATATCTGCTAAACCTCAAGAACAGACCCCAAT
ATTTGCGAAAATTCCCTCCACTTACTCAAGATGTTGAGTGAAGAAATCTTCGATTATTCT
AAGAATGAAATGACCAGCTAACAAATTATTTAATTGAAATCTACTATGAATGAGTAATTC
TAACATATTTATGAACTCTGTTATTACATTACTTCTAACTCAGCTCAAAACTTAAATGCT
GTCAAACCTAGTTTAATAAAGGCTTGTCTTGAAACTTTCCATGTTTATCTTAGTTGGATT
CCTTTAGGTTTTATTATTGATACTGATATGGCTGATATTTTCCTCTTCTTTGTAGTTTAA
ACAGATTTTAAGGAAGTTGCCATAAAATGTTTAACTGAAATTATTCTATTGAAACTAGAT
ATTTGCCAAAATACCAATGAAGTTTTGAAAATGAAGAACAAAATCCTTGATGTTTACTTT
AAATTTATCACAAAAATCTCTGAATCAATTCTTCCTTACAATATTAGCTTACAAAATCAG
AGAAAGACACTCCAAACTCATAATTAGTTTAGATAAATTGATAAGTTTGATAGCATTTGT
ACTAGCATTGTTATATTCTTGACATCATTTTTCTAAACTCATTTGGATTGGATCGAAGAA
TTGGCAAACGACTTCTAAAATCCTGACAGAGTTATGATGGTAGAAAGCATCGATAGAGGT
TTATAATACATTGTTGGAATTAACGAAATCGAAGATGAAAATATTTTTAAGACTTGCGTT
GATTTCTGGCATTTCTTCACTAGTGATTTCTATAAAAAGACTAATAAATTAAAAAATACT
TAAAATTAAAATGGAGGTTAAATCTCAAATCAATTCTTTAATGTAATGAGATTGAATCTC
ACTCCTGAGGCCAATAATGACGCTATGACTATTTAAAAGACTATTTATCCTAAGATAATG
ACCTAAGTCAGAACTATTATTATTTCCAGAATGGCTAAGCCCCAAGAAGTGCTTATTGTT
ATTGAAGAAGGTGTTCCCGTTAAAGAAGAATTAGTTGATACTGAAAATAACTCGCTCTAC
GACCTTCTTAAGGAAATCTTGATCAATCTTTCCAAGCTTGATTGGTCAGATATGAGTAGA
ATTCTCCTTAGTAAGCTCGAAAAGCAACTTGATGGTAGTGAATGGAGCTACGATAATTTG
AATAGTTTATGTTGGGCTATTGGTTCTATTTCAGGCTCAGTTAAGAGCGAAGAAGAAAGA
GCTCTTCTAATTTAAGTTATTAAGGGACTTCTCAATTTGACTGACACAAGAAAGCAAAAA
GAAAGCAAGGCCGTTGTTGCTTCTAATATTATGTATGTCGTTAGTTAATATCCTGTCTTT
TTAAAAACTAATTGGTCTTTCTTAAGAACCGTTGTTAAGAAGCTATTCGAATTCATGGGA
GAAACATTCCCTGGTGTTATGGAAATGGCTGTAAATACTTTCTTAACTGTTAGTTAAAAA
TGTGCAGAAGAATTTGTCAAAGCTTAACAAGAAAAGACTCAAGTTTCTAAAAATCAAACA
AAGATGAATGAAACAGAACCTTACATTCAAACATTAATTAGAACTATTGATGAAAAGGCT
GCAATCCTTGAACCTCAATACCGTCTCACTTTTTACGAAGCTATTGGCTATATTATTAAT
GCTGAATCTGATAGCCAAAAGCAATAAGTTTATCTCGAATCTTCTCTCCGTTCTCAATTA
GAAAATTGGAAACAAATTATATTCAATGCTCAACAAAGTCCTGCCATCCTCGATAAAGAT
GTTGCTATTTAACAAATATCTTTGTTCTTAAAAATAAATGAAAGAATTTGCTCCTCAGTT
GGATTCTGCTATGTATTTATTTTAGGTCAAATTAGCTTGGGAATGAATGAAATATATAAA
TTCTACAGCCAAAATATAAACTAACAAGTGCAATAAGTTGGTAAGCAAGTTATGAACTAC
TCTACTGTAAAGAAATAAAGAACTATTAGAAAGGATATAATAAAGCTCTACATATGTTTC
TTCAAGTGGTGCAGAAAAGACACTCCCTTATTCCAACCCACAACTGTTGCTCAAAGTTTG
ATTGAACCCTTGTAATAATTGCTTGTTGACTATGTTAACTGCCTTGAAGACTGTAGAGAA
CCTGAACTTCTTACTCTCTATCAAGTTATTTTTGAAAACATGGCCGAATACATACAACCC
TTGATCCCTGACACCCTCAAGGGTATCTTCATGGCAACTCTTGGTATGATCAGTAAAGAC
TTTAGTTCTTTCCCTGATCACCGTATTGCTTTCTTCAAACTCTTGAAGGCTGTAGTTTAA
AATGCAATTGAAGCTTTGTTCAATATACCAAGTGACTCTTTTAAGACTATGATTGATTGT
ATTGTTTGGGCCTTCAAGCATCATATTACTGAAATTTCAGACATTGGTTTAGATGTCCTT
ATTTACATTATGAAATAAGTTAACACAAATCAAGGAATTGCTAATTAATTCTATTAAATT
TACTACTTAAATATCTTGAAGGACATTGTAGAAGTCCTTACTGATGGCTTCCACAAAAGT
GGTTTCAAATAACAATGTACAATTTTCTAGATGCTCATCGGAATAGTTAAAGCTCAATTC
TTGACAGTTCCCATCATAGAAGGATAAACCATCGATAATGCTACTTATGTTTATGAATTT
TTAACTAATGCTCTTTCTAATCACTTTAGTAATGTTTCTCTCTAAAAAACCTAATACCAC
ATAAAGAACTTATTTGATAAATACGAAAATCCTCATGATTTTAAGGTGGAACTTAGAGAT
TATTTGATTAACTTAACTATGTATTCTAATGATAATGAACACTTGTATGATAAAAATGAA
ATACAATAATTATAATAGCAATAGATACCTTAATCACAATGA


>TTHERM_00013480(protein)
MMQNYPPEIQSLFQSQKLDQQKVQILDQVTKLMACGDNQKMQMAQQVWKDLKENTEFWVN
VDIVLETSSDYQTKILTLVLMEDTIKQKWQALPQQTQENLKNYILAFVFRQSQQPNPTRD
SLTLLNKCNSIIIQILKFEWNSTWKNFIPDICQTSRTDPNICENSLHLLKMLSEEIFDYS
KNEMTSQQIIQLKSTMNEQFQHIYELCYYITSNSAQNLNAVKPSLIKACLETFHVYLSWI
PLGFIIDTDMADIFLFFVVQTDFKEVAIKCLTEIILLKLDICQNTNEVLKMKNKILDVYF
KFITKISESILPYNISLQNQRKTLQTHNQFRQIDKFDSICTSIVIFLTSFFQTHLDWIEE
LANDFQNPDRVMMVESIDRGLQYIVGINEIEDENIFKTCVDFWHFFTSDFYKKTNKLKNT
QNQNGGQISNQFFNVMRLNLTPEANNDAMTIQKTIYPKIMTQVRTIIISRMAKPQEVLIV
IEEGVPVKEELVDTENNSLYDLLKEILINLSKLDWSDMSRILLSKLEKQLDGSEWSYDNL
NSLCWAIGSISGSVKSEEERALLIQVIKGLLNLTDTRKQKESKAVVASNIMYVVSQYPVF
LKTNWSFLRTVVKKLFEFMGETFPGVMEMAVNTFLTVSQKCAEEFVKAQQEKTQVSKNQT
KMNETEPYIQTLIRTIDEKAAILEPQYRLTFYEAIGYIINAESDSQKQQVYLESSLRSQL
ENWKQIIFNAQQSPAILDKDVAIQQISLFLKINERICSSVGFCYVFILGQISLGMNEIYK
FYSQNINQQVQQVGKQVMNYSTVKKQRTIRKDIIKLYICFFKWCRKDTPLFQPTTVAQSL
IEPLQQLLVDYVNCLEDCREPELLTLYQVIFENMAEYIQPLIPDTLKGIFMATLGMISKD
FSSFPDHRIAFFKLLKAVVQNAIEALFNIPSDSFKTMIDCIVWAFKHHITEISDIGLDVL
IYIMKQVNTNQGIANQFYQIYYLNILKDIVEVLTDGFHKSGFKQQCTIFQMLIGIVKAQF
LTVPIIEGQTIDNATYVYEFLTNALSNHFSNVSLQKTQYHIKNLFDKYENPHDFKVELRD
YLINLTMYSNDNEHLYDKNEIQQLQQQQIPQSQ


>TTHERM_00013480(gene)
ATGATGTAAAACTATCCTCCTGAAATATAAAGTCTTTTCCAATCTTAAAAGCTTGATTAG
CAAAAGGTGCAAATCCTTGACTAGGTTACAAAGCTGATGGCATGTGGTGATAATTAAAAG
GTTTGATATTACTTTTTGTTTTGACATAATTTTCGATATTCCTCTACCAGCCTAATAAAA
AAATAATTAAATAGCTCACAATTCAGGCAAAAAATCCACAAAAAAAATTTTTTAAGCAGA
ATGCTGCTATTTTGCAAAAGGGAAATATTAAAATCAGTTAATTCAGCATTTTAAATAAGC
TGTAAAAGAGCTTAAACGAATTAACTTTATAGATTTTTCCTTGTTTTTTTAATTTTATGT
GCTAAATTTATGAAAATTGTTTGATTTTTTGCTTATTTGTAAATAAATAGATGCAGATGG
CTCAGCAAGTTTGGAAAGACCTTAAAGAGAACACTGAATTTTGGGTCAATGTAGATATTG
TTTTAGAGACTTCTAGCGATTATCAAACTAAAATTCTTACTTTAGTATTGATGGAAGATA
CTATCAAGGTAATTTTGCTTAAATCATTCATATGTTTCATATGCAAATTTCTAGCTTGCA
CTAAAATCCTACTCTCTTTATAGACAAGTTTACTTTAAAATATTTTACCAAATTTTTTTT
AGTTTTGAGCATTTAAGCGAGCAAATTTTTCAAAGGAAGCAGTAAAAAGGCATCAATTAA
CTTATTTAGATATTAATTATAATAAAAATTACATTTTTAAGTAGGATTTAGTAGCAATAT
AAAAAGCTTTATTAGTAGCTAGCTTGCTTTCAATTATTTATGATCTTTTTCTAATTTTAA
AAAAGTAAAAATGGTAAGCTCTCCCTCAACAAACCCAAGAAAATTTAAAGAACTACATCT
TAGCTTTTGTATTTAGGTAAAGTCAATAGCCTAATCCCACTAGAGATTCATTAACACTAT
TAAATAAATGCAACTCTATAATCATTTAAATTTTAAAATTTGAATGGAATTCTACATGGA
AGAACTTTATCCCTGATATCTGCTAAACCTCAAGAACAGACCCCAATATTTGCGAAAATT
CCCTCCACTTACTCAAGATGTTGAGGTAAGCTTTATGCAAACAATATAAAACTAAAATAA
ACCATAAAGAAACTAAAAAATATATTATTCAATTCGTTTTTCAATTTAATTTCGATACCA
ATAAAATAAATAAAATTAGTATACAGGTTGAAAACTTAAATCTAATTCAAAAATAGATAT
ATACATTGATAGATAGATAGATTGATCGATAAATAGATAAATAATAAATAAATAAATTAA
CAAAAGTTATTATATTTTAAAAGATACAAAGATATACATGCCTACAAAAAAATAAATAGA
ATTTTAAATAAAACACTCTTAAAAGAAACAACCCAGAATAAATCATCAAAAAGAAATTAT
CAAAGTTATTTTAGCAATAGCAAGCAGCCTAAAATTAGTGATATAACAAATATAAGACAA
AAATAATACAAAATAAGCAATAAATTATTAGAAAAAAATAAAAAATTACTAGTTATTTTA
ATATAAAAGAGACAAATATGTTTGCAACACTAATTTTGGCAAGAAATAAATTGAAAAAAG
ATAGTTTTTATTTTATTTAATAATTTGATTCATTGATTTATTTAAGATTTAATAATATTT
AATAGTGAAGAAATCTTCGATTATTCTAAGAATGAAATGACCAGCTAACAAATTATTTAA
TTGAAATCTACTATGAATGAGTAATTCTAACATATTTATGAACTCTGTTATTACATTACT
TCTAACTCAGCTCAGTAAATTAATTATATTTATTTGTCTTTTATCTTTTTTCCTAATAAT
ATTTACTTAATTTATAGAAACTTAAATGCTGTCAAACCTAGTTTAATAAAGGCTTGTCTT
GAAACTTTCCATGTTTATCTTAGTTGGATTCCTTTAGGTTTTATTATTGATACTGATATG
GCTGATATTTTCCTCTTCTTTGTAGTTTAAACAGATTTTAAGGAAGTTGCCATAAAATGT
TTAACTGAAATTATTCTATTGAAACTAGATATTTGCCAAAATACCAATGAAGTTTTGAAA
ATGAAGAACAAAATCCTTGATGTTTACTTTAAATTTATCACAAAAATCTCTGAATCAATT
CTTCCTTACAATATTAGCTTACAAAATCAGAGTAAACAAATCACAAAAAACCATTATTAT
AATTAAAATTATTTATTTTATTTAAAATAGGAAAGACACTCCAAACTCATAATTAGTTTA
GATAAATTGATAAGTTTGATAGCATTTGTACTAGCATTGTTATATTCTTGACATCGTAAA
CAATTAATTAATTAATCAATTAATTTTTAGATAAAATAAATTGCAAATTTACAAATAATT
TTGAGCATTTAAAATATCAAATTAGTTTTTAATGCATAAAAATTTGTTTATAAAAATAGA
TTTTTCTAAACTCATTTGGATTGGATCGAAGAATTGGCAAACGACTTCTAAAATCCTGAC
AGAGTTATGATGGTAGAAAGCATCGATAGAGGTTTATAATACATTGTTGGAATTAACGAA
ATCGAAGATGAAAATATTTTTAAGACTTGCGTTGATTTCTGGCATTTCTTCACTAGTGAT
TTCTATAAAAAGACTAATAAATTAAAAAATACTTAAAATTAAAATGGAGGTTAAATCTCA
AATCAATTCTTTAATGTAATGAGATTGAATCTCACTCCTGAGGCCAATAATGACGCTATG
ACTATTTAAAAGACTATTTATCCTAAGATAATGACCTAAGTCAGAACTATTATTATTTCC
AGAATGGCTAAGCCCCAAGAAGTGCTTATTGTTATTGAAGAAGGTGTTCCCGTTAAAGAA
GAATTAGTTGATACTGAAAATAACTCGCTCTACGACCTTCTTAAGGAAATCTTGATCAAT
CTTTCCAAGCTTGATTGGTCAGATATGAGTAGAATTCTCCTTAGTAAGCTCGAAAAGCAA
GTAATCTATTTAGTTTACTTATTTATCACCTAAATTTGTTTAAAATTAATAAATAAAGCT
TGATGGTAGTGAATGGAGCTACGATAATTTGAATAGTTTATGTTGGGCTATTGGTTCTAT
TTCAGGCTCAGTTAAGAGCGAAGAAGAAAGAGCTCTTCTAATTTAAGTTATTAAGGTAAA
GATAAAAAATACTTAAAAATAAGCTTTTTTTTTCTCTTTTTTGATCCAAGAATAACTCAT
TAAAATTAAAAATTAATAGGGACTTCTCAATTTGACTGACACAAGAAAGCAAAAAGAAAG
CAAGGCCGTTGTTGCTTCTAATATTATGTATGTCGTTAGTTAATATCCTGTCTTTTTAAA
AACTAATTGGTCTTTCTTAAGAACCGTTGTTAAGAAGCTATTCGAATTCATGGGAGAAAC
ATTCCCTGGTGTTATGGTAAATAAATGAATAATTCAAAATATGTCTTGAATTTTATATTA
ATTTTTTTTCTATTTTTAGGAAATGGCTGTAAATACTTTCTTAACTGTTAGTTAAAAATG
TGCAGAAGAATTTGTCAAAGCTTAACAAGAAAAGACTCAAGTTTCTAAAAATCAAACAAA
GATGAATGAAACAGAACCTTACATTCAAACATTAATTAGAACTATTGATGAAAAGGCTGC
AATCCTTGAACCTCAATACCGTCTCACTTTTTACGAAGCTATTGGCTATATTATTAATGC
TGAATCTGATAGCCAAAAGCAATAAGTTTATCTCGAATCTTCTCTCCGTTCTCAATTAGA
AAATTGGAAACAAATTATATTCAATGCTCAACAAAGTCCTGCCATCCTCGATAAAGATGT
TGCTATTTAACAAATATCTTTGTTCTTAAAAATAAATGAAAGAATTTGCTCCTCAGTTGG
ATTCTGCTATGTATTTATTTTAGGTAATTAATTATCTTAAATACTATAATCATAGTGACT
TCAAAAATTACTTGATTAAAGAATAAGTTAGCTAATTTATTAATTAATGATAATAAACTT
CCTATTTCATTTTAATAAATGTTAAAATATTTTTTGAATATCACATTCCCCAAAAAATAT
TTATTGAAATTTATTATTTATTGTTTCAAGCAAATTAATTTATTTATTATTATTAAAAAG
GTCAAATTAGCTTGGGAATGAATGAAATATATAAATTCTACAGCCAAAATATAAACTAAC
AAGTGCAATAAGTTGGTAAGCAAGTTATGAACTACTCTACTGTAAAGAAATAAAGAACTA
TTAGAAAGGATATAATAAAGCTCTACATATGTTTCTTCAAGTGGTGCAGAAAAGGTATTC
AAAATTAAGTCTATTTTTATATATTAACTTATAATGAATTAAAAAGACACTCCCTTATTC
CAACCCACAACTGTTGCTCAAAGTTTGATTGAACCCTTGTAATAATTGCTTGTTGACTAT
GTTAACTGCCTTGAAGACTGTAGAGAACCTGAACTTCTTACTCTCTATCAAGTTATTTTT
GAAAACATGGCCGAATACATACAACCCTTGATCCCTGACACCCTCAAGGGTATCTTCATG
GCAACTCTTGGTATGATCAGTAAAGACTTTAGTTCTTTCCCTGATCACCGTATTGCTTTC
TTCAAACTCTTGAAGGCTGTAGTTTAAAATGCAATTGAAGGTATTAATTCATTTTTATTA
ATTTATTATATTAATATTGATTTTCATAAATAGCTTTGTTCAATATACCAAGTGACTCTT
TTAAGACTATGATTGATTGTATTGTTTGGGCCTTCAAGCATCATATTACTGAAATTTCAG
ACATTGGTTTAGATGTCCTTATTTACATTATGAAAGTAATATTAAATTAAGTGATATTTA
TGAGTATTAATTAATTTATTTTTAATTCATTTATCAGTAAGTTAACACAAATCAAGGAAT
TGCTAATTAATTCTATTAAATTTACTACTTAAATATCTTGAAGGACATTGTAGAAGTCCT
TACTGATGGCTTCCACAAAAGTGGTTTCAAATAACAATGTACAATTTTCTAGATGCTCAT
CGGAATAGTTAAAGCTCAATTCGTAAAATCATATTTGACATTTGGAATTATTTTTATAAA
AATATTTTATTAATAGTTGACAGTTCCCATCATAGAAGGATAAACCATCGATAATGCTAC
TTATGTTTATGAATTTTTAACTAATGCTCTTTCTAATCACTTTAGTAATGTTTCTCTCTA
AAAAACCTAATACCACATAAAGAACTTATTTGATAAATACGAAAATCCTCATGATTTTAA
GGTAATAAATTAACAATAAAAAACCATACTTTCTAAATTAAAAAATATATTTTATTTTAA
TTAAAAAAACTAATAAAAACAAATAAATAAATAGGTGGAACTTAGAGATTATTTGATTAA
CTTAACTATGTATTCTAATGATAATGAACACTTGTATGATAAAAATGAAATACAATAATT
ATAATAGCAATAGATACCTTAATCACAATGA