Identifiers and Description

Gene Model Identifier

TTHERM_00013110

Standard Name

None

Aliases

PreTt11817 | 1.m00865

Description

importin-beta amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF00784 ) MyTH4 domain
  • ( PF01851 ) Proteasome/cyclosome repeat
  • ( PF03810 ) Importin-beta N-terminal domain
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.2%

TetraMine Data

TTHERM_00013110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02738.19.997093137033517e-262hypothetical protein (850 aa)
OxytrichaContig15726.0.g396.002077021906841e-60HEAT repeat
WormBaseWBGene000020752.000704504372864e-47locus:imb-1 status:Partially
_confirmed UniProt:Q9BIB8
protein_id:CCD69827.1
SGDYLR347C2.9986404383886433e-43KAP95 Karyopherin beta, forms
a complex with Srp1p/Kap60p; i
nteracts with nucleoporins to
mediate nuclear import of NLS-
containing cargo proteins via
the nuclear pore complex; regu
lates PC biosynthesis; GDP-to-
GTP exchange factor for Gsp1p
Stentor CoeruleusSteCoe_173683.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00013110(coding)
ATGAGTGACTTCAACTAATTGTTGAATACCGTCATGACTGGTGGCGCTGACAGAGCTTAG
GCTGAAAAGCAATTAGAAATAATCTGCATGAACGATACTTCTAGCTTCTTCAAGAATCTC
GTTAATGAGCTCTATAACGAAGGCAATTCAGAATAATTAAGACAACTTGCTGGTACTCTT
ATCAAAAGATCAGTTCGTTTGGAAGTCTAGGGAAAGTACTTATGGAATGTTTTAGACTCA
AATCTAAGAGAAAGCATTAAAAACACTCTTCTTTAAGTCATGATCGTTAAATTCCCTTCA
ATATAAAGAGCCTGCGCTAACGCCATTTCTACCATCTTTACTGTTGAAGTTATTGAAGAT
AGATGGCTCAATCTTATTGATGATTTGGCTAACAGCACTTAACCAACTATCACTACTGAT
ATTAGAAAGGCTGCTATTCTCACTCTTGGTCAAATTTGCGATAAACTTAAAGAATTCAGA
TTAGGTAACAAGTTAGTTGGAGCTACCAAAGAAAAGATTTTGATGGCTATTTTAATTGGT
TTGTCTCCTGATGAGCAAGATTTAGAAATCAGAGAAAACAGTATAATTGCTTTGGGAGAT
TGTGTCGAATTTATGACTGATATTTTAGAAGCTGAATAAGTCAGAGATTATACTGCCTAG
TTGTTAATTACAGCCTTATAGCATCCTGATCAAAAGATTAAAGTAGCTGCTCTTCAACGT
TCAAGTGATTTTGTAAAAGCCATCTATATTTATTTCACCAAATACGTTAGTGCATTCTTC
AGTGCTACTTAGGGATCTATTCTCCACAACGACGAAGATATCTGTATTCCTGCTATGGAA
ATATGGAGCACTCTTGCCAATGAGTACCATGAAAGAGATGAAAAGAATCACTAAGTTAAC
AGAGTTGATGTCCAAGCTATTCAAAACCCCAACCACATTTTACTCGTCTAAGAATAATTA
GTTTAATGTCTTTTATAAAACCTCTTAAAAAATGACATGGATGATGACTCTGAAGCTGAA
TCTGCTATCTAGGAAGCCTCCTAAAAAGCACTCTGTTCCATCGTCGAAAGTGTTGGCGAT
GCAGTTGTTAATACCTTCACTGCTTTTATCACTAACACCCTTACTAACTCTGAATGGACC
TACAGACAAGGAGCTATTCTTGCTTTTGGCTCTTTAATGGAAGGTATCAGTGAAAATGTC
ATCTTAGATTTGATTACCAAAGCCTTTTCAGAGTACGTTAAAACCTTAAATGACCCTGTC
CTTAAAGTTTAAGAAAGTGGTGCCAAATTACTTTCTAAGATCGCTGAATATCATCCTAAG
GCTATCCTTTTGAGATAAAACATTAGCAACGACCTTCCTGTTATTGTTGAATCCCTCAAG
TAAATTCCTTCAATTTCAAGACAAATTTGCTGGTTCTTCTGCTTCCTTGCTGAAAACTTG
GATAAGTATCCTTAAAACTTTATTTCTCAACATTTCGATATCCTCGTAGAATCTCTCATA
AAAAATGCTATCAGAAGCGATTTAGGATCTGGTAACTACAATGTTATCGATGTTTCTTTC
ATGTCCGCCCTTAACATCATTCACTATTCTCGTGCTGTTAATATCGGTTATAAATATCTT
AATTTCTTCCTTACTCTCTTCAAGGATTCTTATGCCATCTAGCCTATTGAAAGAAGAAAT
GCCATTCAATCTGGTATCCTCTCTGCCCTTCATGCTTGCTTATTAACTTTAGATGATAAA
TTCGATCCTAACATGTCAGATACCGTTTTCTAATTAGTTGTTGACCATTTTATGAATATT
AAGAATGTTGATAGTGATGGTATGTATATTGTCAGTGCTCTCGCTACATGCATTGGTACT
AACTTTGTTAAATATTTAGACAAGGTTTGGCCTTATATTGAGCACGCCTTGACTTAGAGA
TAATAGGATTTAGAACTCTTCAAAACTTGCATGGGAACTATTGCTGATGTTGCTAGAGCT
TGTGATAATCAATTTTCATGCAAACTTAATATTTTGAACAACTTATTTGCTGCCCTTGAA
TCTCCTCAATTCAATAGAGATGTCAAGCTCAATATCTTCAGTTGCATAGGTGATATTTGT
CTTGCTACTAAAGAAAATACCCTTCCATACCTTGAAAACCTTGTTAAAATATTTGACATT
GGTTTTACTGCAGCAGTTGAATTGTCTAGATCTGACCAACAAGACATATAGGACTACTCT
GAATAATTAAAGGAAAAACTCATTGAATCCTACACTTGTGTTCTTCATGGTATTAACGAT
ACTCAACAAAACCCTACCTTCTTTAATCATTGCCCTAAACTCGTTGAATTCATCACTCTC
ACATGTGATAAAAACCTCCATCCTACTGTCGATTACGTTAGAAACTGCTTGACATTACTT
GTTGATATTGGTAACTTCTATAAAAACTAGGTTGGACCTTATATAAAAACTAACTTCACT
AAATACCTTATTGATGTATTACAAGAATTCGACTAAAGTGAAGAAGGTAAAGAGACAATC
AGCTTTGCTCACAGAGTAAATAAAACTTATTAATTTCAAAATAAATGTTTATTTAACTAT
TTTTTTAAATTAATTAATTAACAGGTACTTCAAGAACTTTGA


>TTHERM_00013110(protein)
MSDFNQLLNTVMTGGADRAQAEKQLEIICMNDTSSFFKNLVNELYNEGNSEQLRQLAGTL
IKRSVRLEVQGKYLWNVLDSNLRESIKNTLLQVMIVKFPSIQRACANAISTIFTVEVIED
RWLNLIDDLANSTQPTITTDIRKAAILTLGQICDKLKEFRLGNKLVGATKEKILMAILIG
LSPDEQDLEIRENSIIALGDCVEFMTDILEAEQVRDYTAQLLITALQHPDQKIKVAALQR
SSDFVKAIYIYFTKYVSAFFSATQGSILHNDEDICIPAMEIWSTLANEYHERDEKNHQVN
RVDVQAIQNPNHILLVQEQLVQCLLQNLLKNDMDDDSEAESAIQEASQKALCSIVESVGD
AVVNTFTAFITNTLTNSEWTYRQGAILAFGSLMEGISENVILDLITKAFSEYVKTLNDPV
LKVQESGAKLLSKIAEYHPKAILLRQNISNDLPVIVESLKQIPSISRQICWFFCFLAENL
DKYPQNFISQHFDILVESLIKNAIRSDLGSGNYNVIDVSFMSALNIIHYSRAVNIGYKYL
NFFLTLFKDSYAIQPIERRNAIQSGILSALHACLLTLDDKFDPNMSDTVFQLVVDHFMNI
KNVDSDGMYIVSALATCIGTNFVKYLDKVWPYIEHALTQRQQDLELFKTCMGTIADVARA
CDNQFSCKLNILNNLFAALESPQFNRDVKLNIFSCIGDICLATKENTLPYLENLVKIFDI
GFTAAVELSRSDQQDIQDYSEQLKEKLIESYTCVLHGINDTQQNPTFFNHCPKLVEFITL
TCDKNLHPTVDYVRNCLTLLVDIGNFYKNQVGPYIKTNFTKYLIDVLQEFDQSEEGKETI
SFAHRVNKTYQFQNKCLFNYFFKLINQQVLQEL


>TTHERM_00013110(gene)
ATGAGTGACTTCAACTAATTGTTGAATACCGTCATGACTGGTGGCGCTGACAGAGCTTAG
GCTGAAAAGCAATTAGAAATAATCTGCATGAACGATACTTCTAGCTTCTTCAAGAATCTC
GTTAATGAGCTCTATAACGAAGGCAATTCAGAATAATTAAGACAACTTGCTGGTACTCTT
ATCAAAAGATCAGTTCGTTTGGAAGTAATTTATTACCTTCTTTTCAATTTTAGTCTTTTT
AGATTTGTCTAAGGGATAATGATGCCTAATTTATTCTCCTTAATACCTTCATTCTTCTGC
AGATGTTTTATGTTTTTAACCAATAACATTTTTATATAAACAATTAGGTCTAGGGAAAGT
ACTTATGGAATGTTTTAGACTCAAATCTAAGAGAAAGCATTAAAAACACTCTTCTTTAAG
TCATGATCGTTAAATTCCCTTCAATATAAAGAGCCTGCGCTAACGTAAGTCTATTCGATT
AAACTTAACCTTCACCTTTTTATCTTTCTGCTTTTTTCGCTTCCTTTAGCATCCAAATAA
ATAAATAGTAAGCAATAAATAATTTTCCAGTAAAATATTTTTGTTTTTGATATGGAAGAA
GCTCAAAACAGCAACAAACCAACATGAAAATATCGAAGCAAACTGTTTATGGTTGTTTTT
ATCTTAAAATTCATTTTCTTGTTCTGTTTAAAATACTTTCTCGAAATTAGTATCTTTGAA
ATCTAATTTTTTCATAAGCTTTAAATATTTCTTTATATTTTTTAATTTTTCTTGGATCTG
ATTTTGATCTTCGCGGAAAAATTAATTAAATAAAAAACTCAAACAAATTATTTTAATAAA
ATGAGCACCAATTTAAATCTTCCTTTAGAAAATAATTACACCAGCAAAGATTTGCCAAAA
AGCAAAAAACAAACTGCCAAAATTATATTTTAACAAATTATGCTAAAAGCGGAAGCCATT
TTTACAAATAAAACATTAAAATTTTATTTTGGTGAGCTTCACATTAATTATTTTTATTGA
AATATTAGGCCATTTCTACCATCTTTACTGTTGAAGTTATTGAAGATAGATGGCTCAATC
TTATTGATGATTTGGCTAACAGCACTTAACCAACTATCACTACTGATATTAGAAAGGCTG
CTATTCTCACTCTTGGTCAAATTTGCGATAAACTTAAAGAATTCAGATTAGGTAAGCAAA
AATACAAAAAATATTCATTAAATTTTCATATTTCAAGTCAAAAAAGTCTTATTTAGCAAG
ATAACAAAATTAAGTAGCTTGAATAGAAATAGAATTACAATATTTAGCTAGCAAACTTCA
AACAGGATATAGATTTTTTTATCCAATCCTTTAAGTAAATGCTTAAGCATTTAGTAAAAT
AGTTCAAGCCTACTACCAGCTAGCAAGCAACGATGATAAAATTTAGGAATCATTTGTGTA
GCAGATAGCTTTTTGATTCAAAAAATACATTAAAAAGAGAATAATAACTTGCTTAAAAAT
AGAAAAAATATTCAAAATTAAAGATTTCATTTTCCTATTATTAATTCTCTCAAATTCTCT
TATTCATTATTTAATTGAAAATTAGGTAACAAGTTAGTTGGAGCTACCAAAGAAAAGATT
TTGATGGCTATTTTAATTGGTTTGTCTCCTGATGAGCAAGATTTAGAAATCAGAGAAAAC
AGTATAATTGCTTTGGGAGATTGTGTCGAATTTATGACTGATATTTTAGAAGCTGAATAA
GTCAGAGATTATACTGCCTAGTTGTTAATTACAGCCTTATAGCATCCTGATCAAAAGATT
AAAGTAGCTGCTCTTCAACGTTCAAGTGATTTTGTAAAAGCCATCTATATTTATTTCACC
AAATACGTTAGTGCATTCTTCAGTGCTACTTAGGGATCTATTCTCCACAACGACGAAGAT
ATCTGTATTCCTGCTATGGAAATATGGAGCACTCTTGCCAATGAGTACCATGAAAGAGAT
GAAAAGAATCACTAAGTTAACAGAGTTGATGTCCAAGCTATTCAAAACCCCAACCACATT
TTACTCGTCTAAGAATAATTAGTTTAATGTCTTTTATAAAACCTCTTAAAAAATGACATG
GATGATGACTCTGAAGCTGAATCTGCTATCTAGGAAGCCTCCTAAAAAGCACTCTGTTCC
ATCGTCGAAAGTGTTGGCGATGCAGTTGTTAATACCTTCACTGCTTTTATCACTAACACC
CTTACTAACTCTGAATGGACCTACAGACAAGGAGCTATTCTTGCTTTTGGCTCTTTAATG
GAAGGTATCAGTGAAAATGTCATCTTAGATTTGATTACCAAAGCCTTTTCAGAGTACGTT
AAAACCTTAAATGACCCTGTCCTTAAAGTTTAAGTAAACATATAAATTTAATTTTAACTA
CTTAATCTATTGTTTGCCAATAAGCACAAGAAGCAATCAAGCAAGCATCTGAACAAAAAA
ATCCAAATTAGAAAAGCTCTTATTTATTTATTTTATTTTATTTTTTAAATAGGAAAGTGG
TGCCAAATTACTTTCTAAGATCGCTGAATATCATCCTAAGGCTATCCTTTTGAGATAAAA
CATTAGCAACGACCTTCCTGTTATTGTTGAATCCCTCAAGTAAATTCCTTCAATTTCAAG
ACAAATTTGCTGGTTCTTCTGCTTCCTTGCTGAAAACTTGGATAAGTATCCTTAAAACTT
TATTTCTCAACATTTCGATATCCTCGTAGAATCTCTCATAAAAAATGGTAACTATAAAAA
TAGTTTTATGAAATTTTATTGAAAGAATATTTTATTTAATTATAAATAGCTATCAGAAGC
GATTTAGGATCTGGTAACTACAATGTTATCGATGTTTCTTTCATGTCCGCCCTTAACATC
ATTCACTATTCTCGTGCTGTTAATATCGGTTATAAATATCTTAATTTCTTCCTTACTCTC
TTCAAGGATTCTTATGCCATCTAGCCTATTGAAAGAAGAAATGCCATTCAATCTGGTATC
CTCTCTGCCCTTCATGTAATTTAATCAATTTATTCACATACAAAAATAAATAAATAAACA
AATATTTTATCTAAAAAAAAATTATTAAAATTTTTTAATGAAATAATTTTATAAATGAAG
GCTTGCTTATTAACTTTAGATGATAAATTCGATCCTAACATGTCAGATACCGTTTTCTAA
TTAGTTGTTGACCATTTTATGAATATTAAGAATGTTGATAGTGATGGTATGTATATTGTC
AGTGCTCTCGCTACATGCATTGGTACTAACTTTGTTAAATATTTAGACAAGGTTTGGCCT
TATATTGAGCACGCCTTGACTTAGAGATAATAGGATTTAGAACTCTTCAAAACTTGCATG
GGAACTATTGCTGATGTTGCTAGAGCTTGTGATAATCAATTTTCATGCAAACTTAATATT
TTGAACAACTTATTTGCTGCCCTTGAATCTCCTCAATTCAATAGAGATGTCAAGCTCAAT
ATCTTCAGTTGCATAGGTGATATTTGTCTTGCTACTAAAGAAAATACCCTTCCATACCTT
GAAAACCTTGTTAAAATATTTGACATTGGTTTTACTGCAGCAGTTGAATTGTCTAGATCT
GACCAACAAGACATATAGGACTACTCTGAATAATTAAAGGAAAAACTCATTGAATCCTAC
ACTTGTGTTCTTCATGGTATTAACGATACTCAACAAAACCCTACCTTCTTTAATCATTGC
CCTAAACTCGTTGAATTCATCACTCTCACATGTGATAAAAACCTCCATCCTACTGTCGTA
ATAATTTAGCAATATTTGAAATCAGCTAAAAATTAATTAAATTTATTTATAATTAAATGA
ATAGGATTACGTTAGAAACTGCTTGACATTACTTGTTGATATTGGTAACTTCTATAAAAA
CTAGGTTGGACCTTATATAAAAACTAACTTCACTAAATACCTTATTGATGTATTACAAGA
ATTCGACTAAAGTGAAGAAGGTAAAGAGACAATCAGCTTTGCTCACAGAGTAAATAAAAC
TTATTAATTTCAAAATAAATGTTTATTTAACTATTTTTTTAAATTAATTAATTAACAGGT
ACTTCAAGAACTTTGA