Identifiers and Description

Gene Model Identifier

TTHERM_00011730

Standard Name

None

Aliases

PreTt11779 | 1.m00827

Description

peptide chain release factor 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03462 ) PCRF domain
  • ( PF00472 ) Peptidyl-tRNA hydrolase domain
  • ( TIGR00019 ) peptide chain release factor 1
  • ( TIGR00020 ) peptide chain release factor 2
  • ( TIGR03072 ) putative peptide chain release factor

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 23.4%

TetraMine Data

TTHERM_00011730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02773.19.997093137033517e-262MCM2/3/5 family protein (1371
aa)
OxytrichaContig20615.0.g332.9998512931988133e-83RF-1 domain
DictyBaseDDB_G02831759.996162112727537e-67prfA on chromosome: 4 position
360952 to 362348
SGDYGL143C5.001636743996964e-56MRF1 Mitochondrial translation
release factor, involved in s
top codon recognition and hydr
olysis of the peptidyl-tRNA bo
nd during mitochondrial transl
ation; lack of MRF1 causes mit
ochondrial genome instability
WormBaseWBGene000209931.9998745702418095e-48Probable peptide chain release
factor 1, mitochondrial sta
tus:Confirmed UniProt:O44568
protein_id:CCD65509.1
Stentor CoeruleusSteCoe_378781.6458114310822737e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011730(coding)
ATGATAAAAAATATATTTAAGTTACTCCCTATTTCGCTTAGAGCTATACCTCTTAAATAG
CAATAAAACAGCTTTTCATAGATCTGTTCTCTTTATAATACTAAATTATTCAAAGTTATT
AATTTAATACAAACAAATAATAAATGCTTCTTTAGCTTTCGTGCAAAAGAAACATTCAAG
AAAAAAACATCTTCTTTAGAGATAGAAACTCACTTTTAAGTATCTGATTTAACTCGTTGC
ATTTATAGAAGAATGAAGTAGTTCCATAATGAATATACAGACATTCAAAAAATACTATCA
TAGGAACAATAATAAGCAGATATTAATTTAGAATAGCTCAGAAAGAAAATAAATGTTCTT
TAGCCACTTAATGACGTCTTTGAAAAATTGGAGTAGAATATAAAAACTTTATAAGAGTTA
TAAAAGTAAAAGGAAGAAAGTGCGAGTGATCCTGAAATGCTCGCTCTCATAGAAGAAGAA
ATGGAAAATTCTAAGTAATTAATAGATGAGCTGTAAGATGAATGCTTAGAACAACTTCTT
CCAAAAGGAAAGCATGACGATTGCAGTGAAATAACATTAGAAGTTAGAGGAGGAGCTGGT
GGTAGTGAAAGTTCTCTATTTGCTGAAGAAGTTTTTAAAATGTACCAAGCTTTTTTTGCT
TAGCAAGGATATTAATTTAGTATCGACTCATTTTAAGTCGATATGGCCATTAACAAAGGA
TGTAAATTGGGTGTTTTAAAAGTATCTGGTACTAATATTTATAAAAAAATGATGAATGAA
TCAGGTGTCCATAAAGTTATTAGAGTGCCTGAAACAGAAAGTAAAGGCAGATTGCATTCA
AGTACCATATCTGTTGTCGTTATGCCAGTTGTTCCCATGGATTTCAAAGTTGATGAAAAG
GATTTGAAATTCGAATTTATGAGATCTCAAGGTGCTGGTGGACAGCATGTTAACAAGGTA
GAATCCGCATGCAGAGTTACACACTTGCCAACTGGAATAAGTGTGCTTTGTTAGGATGAT
AGACAATAAGAAAGAAACAAATAAAGAGCATTAAAGCTTTTAACTGAGAAACTTTTCCAA
GTAGAAGTAGAAAAATCTAATTAATAATAGAGCGATTAGAGAAAAAGCTAGATTGGAGGC
GGTGATAGAAGTGATAAAATTCGTACATATAATTTTCCTTAGGGAAGAATTACAGATCAC
AGAACTAATTTAACCCTTTTTGGAATAGAAAAAATGATGAAAGGAGAATTTCTTGAAGAA
TTCATAGATGAATATGAAGAGAAAGTCAATAACGAACTAATTGAGAGTGTATTAAAATAA
CTAGAAGAAGATGAAAACTAATCTCAACCTAAAAATTGA


>TTHERM_00011730(protein)
MIKNIFKLLPISLRAIPLKQQQNSFSQICSLYNTKLFKVINLIQTNNKCFFSFRAKETFK
KKTSSLEIETHFQVSDLTRCIYRRMKQFHNEYTDIQKILSQEQQQADINLEQLRKKINVL
QPLNDVFEKLEQNIKTLQELQKQKEESASDPEMLALIEEEMENSKQLIDELQDECLEQLL
PKGKHDDCSEITLEVRGGAGGSESSLFAEEVFKMYQAFFAQQGYQFSIDSFQVDMAINKG
CKLGVLKVSGTNIYKKMMNESGVHKVIRVPETESKGRLHSSTISVVVMPVVPMDFKVDEK
DLKFEFMRSQGAGGQHVNKVESACRVTHLPTGISVLCQDDRQQERNKQRALKLLTEKLFQ
VEVEKSNQQQSDQRKSQIGGGDRSDKIRTYNFPQGRITDHRTNLTLFGIEKMMKGEFLEE
FIDEYEEKVNNELIESVLKQLEEDENQSQPKN


>TTHERM_00011730(gene)
ATGATAAAAAATATATTTAAGTTACTCCCTATTTCGCTTAGAGCTATACCTCTTAAATAG
CAATAAAACAGCTTTTCATAGATCTGTTCTCTTTATAATACTAAATTATTCAAAGTTATT
AATTTAATACAAACAAATAATAAATGCTTCTTTAGCTTTCGTGCAAAAGAAACATTCAAG
AAAAAAACATCTTCTTTAGAGATAGAAACTCACTTTTAAGTATCTGATTTAACTCGTTGC
ATTTATAGAAGAATGAAGTAGTTCCATAATGAATATACAGACATTCAAAAAATACTATCA
TAGGAACAATAATAAGCAGATATTAATTTAGAATAGCTCAGAAAGAAAATAAATGTTCTT
TAGCCACTTAATGACGTCTTTGAAAAATTGGAGTAGAATATAAAAACTTTATAAGAGTTA
TAAAAGTAAAAGGAAGAAAGTGCGAGTGATCCTGAAATGCTCGCTCTCATAGAAGAAGAA
ATGGAAAATTCTAAGTAATTAATAGGTAAAAGTTTAATTTGAGTCTACTTAAAGATATAT
CAAAACTATATAGTTTATTCGTAAAGATTTTATATTAAATCAATATTTATTAAATTTTAA
CAATATTGATAATCAAGAATATTTCTAGAAATTATTAATTTTAATGTTCCTAATCCATTT
TTTACATGCAAACATGCATCTATGCTTGCTTACCTTGCATGCTTTTTGGATTTATTTATC
TTTGAGCATTTATTTAATTATTTATTATACTATCAATTAATTTATTAAATCTATTAAATT
AACTTGTTTTAAATTCTAAGTTAATTTCATTTTTATTTGAAATACTAGATGAGCTGTAAG
ATGAATGCTTAGAACAACTTCTTCCAAAAGGAAAGCATGACGATTGCAGTGAAATAACAT
TAGAAGTTAGAGGAGGAGCTGGTGGTAGTGAAAGTTCTCTATTTGCTGAAGAAGTTTTTA
AAATGTACCAAGCTTTTTTTGCTTAGCAAGGATATTAATTTAGTATCGACTCATTTTAAG
TCGATATGGCCATTAACAAAGGATGTAAATTGGGTGTTTTAAAAGTATCTGGTACTAATA
TTTATAAAAAAATGATGAATGAATCAGGTGTCCATAAGTAAATTGATAATAAAGATTCAA
ATTTAAAAATTAATTAGTCATTTTATTTTAAATGCAGAGTTATTAGAGTGCCTGAAACAG
AAAGTAAAGGCAGATTGCATTCAAGTACCATATCTGTTGTCGTTATGCCAGTTGTTCCCA
TGGTAATTAATTTAAATTTTACACATTTTATTTGTTTTGAATTAATTTTTATTATTATTT
ATTAAAAAGGATTTCAAAGTTGATGAAAAGGATTTGAAATTCGAATTTATGAGATCTCAA
GGTGCTGGTGGACAGCATGTTAACAAGGTAGAATCCGCATGCAGGTAAATAATAAATATA
CTTGTAATATATTTGTTAACTAATTTTCTCTTAAATTAAATTTTAGAGTTACACACTTGC
CAACTGGAATAAGTGTGCTTTGTTAGGATGATAGACAATAAGAAAGAAACAAATAAAGAG
CATTAAAGGTAATTTTTAGAGTTACTTGATATTTAATATTTTAAAAAGATCGAAACTGAT
ATTAAAAAAAATAGAAAATCGAGGCTTGATTTTTAAAAAATTTATACATCATTTTACCAA
AATTGTATGAGAAATAAAGAAAAACAAATAAATAAATAAATAAATAAATATAAATTGATG
TTAAAAATCTAATATAAAAGTTCGATATATAAGTTGGTATAAACCTCGAAATAATTGAAT
ATAATAAAAAATTATTATTTGAAGAAAGAAGTTTCACTATTTTTTGATTATCAAATAAAT
AAATAATATGAATCTATTTTAAAAAAAGCTTTTAACTGAGAAACTTTTCCAAGTAGAAGT
AGAAAAATCTAATTAATAATAGAGCGATTAGAGAAAAAGCTAGATTGGTACTTAATTATT
TTTATTTTTTCATTTCTCTTTTTTAAAAGAATGTATAATTTTCAAATAAATAGGAGGCGG
TGATAGAAGTGATAAAATTCGTACATATAATTTTCCTTAGGGAAGAATTACAGATCACAG
AACTAATTTAACCCTTTTTGGAATAGAAAAAATGATGAAAGGAGAATTTCTTGAAGAATT
CATAGATGAATATGAAGAGAAAGTCAATAACGAACTAATTGAGAGTGTATTAAAATAACT
AGAAGAAGATGAAAACTAATCTCAACCTAAAAATTGA