Identifiers and Description

Gene Model Identifier

TTHERM_00011180

Standard Name

APRT1 (adenine phosphoribosyltransferase1)

Aliases

PreTt11724 | 1.m00772

Description

Phosphoribosyl transferase domain containing protein. D127N mutation confers 6-methylpurine (6mp) resistance.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00201 ) comF family protein
  • ( PF00156 ) Phosphoribosyl transferase domain
  • ( TIGR00336 ) orotate phosphoribosyltransferase
  • ( TIGR01090 ) adenine phosphoribosyltransferase
  • ( TIGR01744 ) xanthine phosphoribosyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00011180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02834.13.0002649496582814e-114phosphoribosyl transferase dom
ain-containing protein (180 aa
)
SGDYML022W9.99893167504554e-35APT1 Adenine phosphoribosyltra
nsferase, catalyzes the format
ion of AMP from adenine and 5-
phosphoribosylpyrophosphate; i
nvolved in the salvage pathway
of purine nucleotide biosynth
esis
WormBaseWBGene000205578.997017754360629e-34Adenine phosphoribosyltransfer
ase status:Confirmed UniPr
ot:P91455 protein_id:CCD6297
5.1
OxytrichaContig672.0.g982.000470901975128e-28Phosphoribosyl transferase dom
ain
DictyBaseDDB_G02701742.0009605191578312e-25aprt on chromosome: 1 position
4368158 to 4368757

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29570682: Akematsu T, Findlay A, Fukuda Y, Pearlman RE, Loidl J, Orias E, P Hamilton E (2018) Resistance to 6-Methylpurine is Conferred by Defective Adenine Phosphoribosyltransferase in Tetrahymena. Genes 9(4):

Sequences

>TTHERM_00011180(coding)
ATGGATTACTAAAATTAAGAAATAGGTAAAGTTATTAGCGAAAACTTCAGAAATATTCCT
GATTTCCCTTAACCTGGTATTATCTTTAAAGATATTGCTCCTCTCCTCTCTAATCCTGCC
ATTTTTAAGCGTATTACTGATGCTTTTGTAATTGCTTTGAAGGACATTGATTTTGATAAA
ATTGTTATCTTAGAATCTAGAGGTTTTATTTTTGGAACCGCTATTGGTTTACAAATGGGA
AAGGGATTAATTTTAATCAGAAAGAAAGGCAAACTACCTGGTAAGGTTGAATAATTCTCA
TTCGACTTAGAATACGGTAAGGATGTTTTTGAAATTCAAAGTGATGCTTTAGCTAAAGGT
GAAAAAGTTGTTATTGTTGATGATATTCTAGCTACTGGTGGAACTGCTGATGCAGCTTGC
AGATTAGTTGAAAAGGTAGGAGGAGTAGTATAAGCTGTTATGTTCCTTTACCAAATTAAG
GATCTTAAGGGCGAAGAAAGATTATCTAAATACAAGGTTATTAATCTTCATATTGAATGA


>TTHERM_00011180(protein)
MDYQNQEIGKVISENFRNIPDFPQPGIIFKDIAPLLSNPAIFKRITDAFVIALKDIDFDK
IVILESRGFIFGTAIGLQMGKGLILIRKKGKLPGKVEQFSFDLEYGKDVFEIQSDALAKG
EKVVIVDDILATGGTADAACRLVEKVGGVVQAVMFLYQIKDLKGEERLSKYKVINLHIE


>TTHERM_00011180(gene)
ATGGATTACTAAAATTAAGAAATAGGTAAAGTTATTAGCGAAAACTTCAGAAATATTCCT
GATTTCCCTTAACCTGGTATTATCTTTAAAGATATTGCTCCTCTCCTCTCTAATCCTGCC
ATTTTTAAGCGTATTACTGATGCTTTTGTAATTGCTTTGAAGGACATTGATTTTGATAAA
ATTGTTATCTTAGAATCTAGAGGTTTTATTTTTGGAACCGCTATTGGTTTACAAATGGGA
AAGGGATTAATTTTAATCAGAAAGAAAGGCAAACTACCTGGTAAGGTTGAATAATTCTCA
TTCGACTTAGAATACGGTAAGGATGTTTTTGAAATTCAAAGTGATGCTTTAGCTAAAGGT
GAAAAAGTTGTTATTGTTGATGATATTCTAGCTACTGGTGGAACTGCTGATGCAGCTTGC
AGATTAGTTGAAAAGGTAGGAGGAGTAGTATAAGCTGTTATGTTCCTTTACCAAATTAAG
GATCTTAAGGGCGAAGAAAGATTATCTAAATACAAGGTTATTAATCTTCATATTGAATGA