Identifiers and Description

Gene Model Identifier

TTHERM_000079389

Standard Name

None

Aliases

None

Description

papain family cysteine protease

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 66%

TetraMine Data

TTHERM_000079389

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07002.11.9996807727516527e-135papain family cysteine proteas
e containing protein (321 aa)
OxytrichaContig16089.0.g21.9994274381022833e-63Papain family cysteine proteas
e
WormBaseWBGene000007761.0002546821282671e-50locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
DictyBaseDDB_G02909571.0002546821282671e-50cprA on chromosome: 5 position
4812963 to 4814596
Stentor CoeruleusSteCoe_26289.854154686111257e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000079389(coding)
ATGAACAAATTACTTCTTGTTCTTACCGGAGTTCTAGCTCTCGGTAGCACTCTCTACTTA
CTTTCAAATTAATCTTCTAACCTAAGATTGAATATTGAAAACGATATTACCATTCAATGG
AAGTTGTTCAAGAGCAGATTCAATAAGAGATACGCTGATCCTATCACTGAATCCTACAGA
TTACAAGTATTCGCCTCTAACTACTTAAGAGTTTTGTCTGATGTTACCGGTACTTTTGGT
GTTACCTAATTCTTCGATTTGACTGAAGAAGAGTTCGCTGCTACTTACTTAACTCTTAGA
GTTTAACGTAACGTAAATGCTACTGTTTCAAGCCCATCTACCCCTAAGGGACAATATGAT
GTTAACTGGGTTACTAGAGGAAAAGTCTCTGCTGTTAAGGACTAAGGCTAATGCGGTTCA
TGTTGGGCTTTCTCTACCACTGGTTCAGTTGAATCAGCCCTTATCATTGCTGGTTATGCC
AACCAAACTATTGATTTGTCTGAATAATAATTGGTTGACTGTTCTGCAACCAACTACGGT
TGCGGTGGTGGCTGGATGGACAACGCTTTTGAATACATCGAAGAAAGTCCCTTAACTACC
AATTCTAACTATCCTTACGTTGCTGTTGACTAAGCTTGCAATTCAACTGAAATCTATGGA
GTTCTCTACTCTCTTAGCAACTACACTGATGTTGAAAGTGGTAACACTGTCTAATTAAAG
TAATATCTTTAATAATAACCCCTTTCTATTGCTGTTGATGCTTCATACTGGTATTTGTAC
AATAGTGGTATCTTCTCAAATTGCGGTTAAAACCTTAACCATGGTGTCCTTTTGGTAGGT
TTTAACAGCACTGAAGGTTCTTGGCTTGTTAAGAACTCATGGGGTACCAGCTGGGGTGAA
TAAGGTTATATTAGACTTGCTGACGGTAACACTTGCGGTCTTGCTAATGCTGCCTCTTAT
CCCACTGTTGTCCCACCTATTACTTCCTACTGA


>TTHERM_000079389(protein)
MNKLLLVLTGVLALGSTLYLLSNQSSNLRLNIENDITIQWKLFKSRFNKRYADPITESYR
LQVFASNYLRVLSDVTGTFGVTQFFDLTEEEFAATYLTLRVQRNVNATVSSPSTPKGQYD
VNWVTRGKVSAVKDQGQCGSCWAFSTTGSVESALIIAGYANQTIDLSEQQLVDCSATNYG
CGGGWMDNAFEYIEESPLTTNSNYPYVAVDQACNSTEIYGVLYSLSNYTDVESGNTVQLK
QYLQQQPLSIAVDASYWYLYNSGIFSNCGQNLNHGVLLVGFNSTEGSWLVKNSWGTSWGE
QGYIRLADGNTCGLANAASYPTVVPPITSY


>TTHERM_000079389(gene)
ATGAACAAATTACTTCTTGTTCTTACCGGAGTTCTAGCTCTCGGTAGCACTCTCTACTTA
CTTTCAAATTAATCTTCTAACCTAAGATTGAATATTGAAAACGATATTACCATTCAATGG
AAGTTGTTCAAGAGCAGATTCAATAAGAGATACGCTGATCCTATCACTGAATCCTACAGA
TTACAAGTATTCGCCTCTAACTACTTAAGAGTTTTGTCTGATGTTACCGGTACTTTTGGT
GTTACCTAATTCTTCGATTTGACTGAAGAAGAGTTCGCTGCTACTTACTTAACTCTTAGA
GTTTAACGTAACGTAAATGCTACTGTTTCAAGCCCATCTACCCCTAAGGGACAATATGAT
GTTAACTGGGTTACTAGAGGAAAAGTCTCTGCTGTTAAGGACTAAGGCTAATGCGGTTCA
TGTTGGGCTTTCTCTACCACTGGTTCAGTTGAATCAGCCCTTATCATTGCTGGTTATGCC
AACCAAACTATTGATTTGTCTGAATAATAATTGGTTGACTGTTCTGCAACCAACTACGGT
TGCGGTGGTGGCTGGATGGACAACGCTTTTGAATACATCGAAGAAAGTCCCTTAACTACC
AATTCTAACTATCCTTACGTTGCTGTTGACTAAGCTTGCAATTCAACTGAAATCTATGGA
GTTCTCTACTCTCTTAGCAACTACACTGATGTTGAAAGTGGTAACACTGTCTAATTAAAG
TAATATCTTTAATAATAACCCCTTTCTATTGCTGTTGATGCTTCATACTGGTATTTGTAC
AATAGTGGTATCTTCTCAAATTGCGGTTAAAACCTTAACCATGGTGTCCTTTTGGTAGGT
TTTAACAGCACTGAAGGTTCTTGGCTTGTTAAGAACTCATGGGGTACCAGCTGGGGTGAA
TAAGGTTATATTAGACTTGCTGACGGTAACACTTGCGGTCTTGCTAATGCTGCCTCTTAT
CCCACTGTTGTCCCACCTATTACTTCCTACTGA