Identifiers and Description

Gene Model Identifier

TTHERM_000011759

Standard Name

None

Aliases

None

Description

DNA replication licensing factor MCM4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_000011759

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_41880
Tetrahymena borealisEI9_02772.19.997093137033517e-262hypothetical protein (753 aa)
DictyBaseDDB_G02829339.997093137033517e-262mcm7 on chromosome: 4 position
12867 to 15427
OxytrichaContig3796.0.g339.997093137033517e-262MCM2/3/5 family
SGDYBR202W9.997093137033517e-262MCM7 Component of the heterohe
xameric MCM2-7 complex, which
primes origins of DNA replicat
ion in G1 and becomes an activ
e ATP-dependent helicase that
promotes DNA melting and elong
ation in S-phase; forms an Mcm
4p-6p-7p subcomplex
WormBaseWBGene000031598.001386819130079e-160locus:mcm-7 status:Confirmed
UniProt:O16297 protein_id
:CCD68490.1

General Information

Paragraph NoGene NameParagraph Text
140TTHERM_000011759Based on protein sequence homology, this is more likely MCM7

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000011759(coding)
ATGTAAGGTGAATATAGATTCTATAATCCTAAATATCTTGAAAAGACAGCTTTACTAACT
GAATTTATAACTTCTTTCAAGTAAATTTCTAAGGACAATTCTTAACAAACTCATGGAGAT
CTTAAATATATGAATTTACTCTAAAGAGTAGCTAACAATTAAGATAGTCGTGTAGATATT
TTAATGGAAGATTTAGAAGAATACTTTAAATCTGAAAAGGATAGACCTTTAATTGATGCA
ATTTAAAGAAACACATCTCGTTTCGTTGATATCCTTTCTAAGGTTTGTGACACTGTTATG
CCAGCTCGTAATGTTCCTATGACTTCTGATGAAGAAATGGAAAACATGCAACAAATTTTA
AACGATTAAAGAATGAGTAATATGGAAGGTGATTAAAATAAGGATGATAATGTCAAAAAT
AGATTGAATCCTCTTTTAAACAGAAAGTTTTAATTATTTATAATAAGAGGCCCTGATAGC
AAACAAAAGATCACTCCTATTAGAAACTTAAAGTCAGAGGATATTGGTGGATTGGTAACA
ATAAAAGCAATAGTTATTAGAACCAGTGACGTCAAGCCTATGATGCAAGTAGCATGTTAT
ATTTGTGATACTTGTGGTTGTGAATTATATCAAACAGTCTCATCCAAGACCTTCACTCCT
TTACAAGAATGTATTTCAAATACCTGTAAGACCAATCGTACAAAAGGCAAAGTAGTTATC
AGTCCTTCTTCCAGTGTTTTCTAAGCTTATTAAGAAATCAGAGTTCAAGAAACTTCTGAT
CAAATTCCTTAAGGCAATATCCCTAGAAGATTTTTAATTCTTGCTAAAGGCGCAAATGTC
AATTAATGTTCTCCTGGTGATTTAGTCACTGTTTAGGGTGTTTTCCTCCCTTCTGAGCAT
GATGATTACCTTTCAAGAAGCAACTTGATCATGGAAACTTTTATTGAATCCTATAAAATT
TAAAAAGAAAAGAAGAGCTATTCAGACATGCAAATTGAAGAAGATATTTAGATTAAGATT
TAAGAAATGAGAGAAGAAATGACTGATGAGTAAATTTATGAACTACTTGCTAGATCTATC
GCACCTGAAATCTATGGTCTTGAAGATGTCAAGAAAGCTCTCCTTTTACTCATGGTTGGT
GGTACCTCTTTGGAAACAAAGGACGGCATGAGAATCAGAGGTGACATTAACATGGCTATG
ATTGGTGATCCTGGTGTTGCTAAGAGTTAATTGTTAAAACACATTGCTAGAGTCTCTCCT
AGAGGTATTTACACTACAGGTAAAGGTTCCAGTGGTGTCGGTCTAACTGCTTCTTTGATT
AAAGATCCCATTACTCACGAAATGTCATTAGAAGCTGGTGCCCTCGTCCTTGCTGATATG
GGTGTCTGTTGTATTGATGAATTCGATAAGATGAATGAAAATGATAGAACTTCCATCCAT
GAAGTTATGGAATAACAAACCGTCTCTATTGCTAAGGCAGGTATGGCTACTTCTCTCAAC
GCCAGAACTTCCATCCTTGCTGCTGCCAATCCTTTATATGGAAGATATAACAAAAAGGTT
TCTCCCCATAAAAACATCAACCTACCTTATGCTCTTCTTTCAAGATTTGATTTGGTTTTC
ATCTTACTTGATACTGCTTCTGAAGAAAACGATAGCAGATTAGCTAAGCACATTCTATAA
GTACATAAAACATTATAACCTCCTAAATCAACTGAAGAAACAGTTGACGCAGCTGTGATT
AAAGCTTACATCAGCTAAGCTAAGTAGTTTTAACCTACTATCAATAAAGAACTCCATGAT
TTCTTAACTTCAAGATATTTAGAAAAAAGAAAAGCACAAAATGATAAAAGCAAAGATGGT
TACAATTATACTACTCCAAGAACTTTACTTGGTATATTGCGTCTTGCTTAAAGTTTGGCT
AAATTGAGATTCTCAGAAACTGTCTCATAAAAAGATGTAGATGAAGCCTTGAGATTAATA
GAAGAATCTCAAAAATCTGTATAAGAAGGCTAAGATGATGGCAGTACTTAACAAAAAATT
TAAAAAGACTTCAAATCTGAAATCTATTAAATTATCTCTAAACTGTGTCTTAAATAAAAA
GATTTTATTATTTCAGAATCTGAAGCTCTTAAATAAGTTTTAGCTAAAGGTTATACAAAC
ACCTAATTTGAAAAAACTTTAGATTACTACAATTAAATTGATCTTTTAATGGTTAACCAA
GAAACTAAAAAAATTACCTACATAGTTACCAAGGAATGA


>TTHERM_000011759(protein)
MQGEYRFYNPKYLEKTALLTEFITSFKQISKDNSQQTHGDLKYMNLLQRVANNQDSRVDI
LMEDLEEYFKSEKDRPLIDAIQRNTSRFVDILSKVCDTVMPARNVPMTSDEEMENMQQIL
NDQRMSNMEGDQNKDDNVKNRLNPLLNRKFQLFIIRGPDSKQKITPIRNLKSEDIGGLVT
IKAIVIRTSDVKPMMQVACYICDTCGCELYQTVSSKTFTPLQECISNTCKTNRTKGKVVI
SPSSSVFQAYQEIRVQETSDQIPQGNIPRRFLILAKGANVNQCSPGDLVTVQGVFLPSEH
DDYLSRSNLIMETFIESYKIQKEKKSYSDMQIEEDIQIKIQEMREEMTDEQIYELLARSI
APEIYGLEDVKKALLLLMVGGTSLETKDGMRIRGDINMAMIGDPGVAKSQLLKHIARVSP
RGIYTTGKGSSGVGLTASLIKDPITHEMSLEAGALVLADMGVCCIDEFDKMNENDRTSIH
EVMEQQTVSIAKAGMATSLNARTSILAAANPLYGRYNKKVSPHKNINLPYALLSRFDLVF
ILLDTASEENDSRLAKHILQVHKTLQPPKSTEETVDAAVIKAYISQAKQFQPTINKELHD
FLTSRYLEKRKAQNDKSKDGYNYTTPRTLLGILRLAQSLAKLRFSETVSQKDVDEALRLI
EESQKSVQEGQDDGSTQQKIQKDFKSEIYQIISKLCLKQKDFIISESEALKQVLAKGYTN
TQFEKTLDYYNQIDLLMVNQETKKITYIVTKE


>TTHERM_000011759(gene)
ATGTAAGGTGAATATAGATTCTATAATCCTAAATATCTTGAAAAGACAGCTTTACTAACT
GAATTTATAACTTCTTTCAAGTAAATTTCTAAGGACAATTCTTAACAAACTCATGGAGAT
CTTAAATATATGAATTTACTCGTAATAAATCATCTAATTTATTAAATTTAAAAACAAATG
CATATGCAAGCAAGCAAGCACTAATAATGAACTTAAAATATGCTTTAAACATATGATACA
ATGCAATTTACATTTTTTCATATAAATATTAGTAAAGAGTAGCTAACAATTAAGATAGTC
GTGTAGATATTTTAATGGAAGATTTAGAAGAATACTTTAAATCTGAAAAGGATAGACCTT
TAATTGATGCAATTTAAAGAAACACATCTCGTTTCGTTGATATCCTTTCTAAGGTTTGTG
ACACTGTTATGCCAGCTCGTAATGTTCCTATGACTTCTGATGAAGTAATTCATTAATTAT
AATTTTTTACTAAAAGATAATATACAAATTTAGCACATAAGCATAATTGACAATATAAAG
TTGCTCCAAATTCTCAACACTATCAAAATTGTCAAGAAAATAGAAATAAATTTCAGTGAA
AATTGAGCAGCTTCACTGAAGAAATAGTCTAAGAAATATTTTAAAAGCAAAAATTAATTT
TTAGACATATTTTTTTGAGCCCTTTGAATTTTTTTGAAGGGAAATAAAAGATATTTGTTT
GCTTTGTATGAAAAAAGTAAATTTCAACATAAATAAATAAATGAATATCATCTACTTACT
TATTTGCTAATTATTTGTTAAATTATTTTAATAGGAAATGGAAAACATGCAACAAATTTT
AAACGATTAAAGAATGAGTAATATGGAAGGTGATTAAAATAAGGATGATAATGTCAAAAA
TAGATTGAATCCTCTTTTAAACAGAAAGTTTTAATTATTTATAATAAGAGGCCCTGATAG
CAAACAAAAGATCACTCCTATTAGAAACTTAAAGTCAGAGGATATTGGTGGATTGGTAAC
AATAAAAGCAATAGTTATTAGAACCAGTGACGTCAAGCCTATGATGCAAGTAGCATGTTA
TATTTGTGATACTTGTGGTTGTGAATTATATCAAACAGTCTCATCCAAGACCTTCACTCC
TTTACAAGAATGTATTTCAAATACCTGTAAGACCAATCGTACAAAAGGCAAAGTAGTTAT
CAGTCCTTCTTCCAGTGTTTTCTAAGCTTATTAAGAAATCAGAGTTCAAGAAACTTCTGA
TCAAATTCCTTAAGGCAATATCCCTAGAAGATTTTTAATTCTTGCTAAAGGCGCAAATGT
CAATTAATGTTCTCCTGGTGATTTAGTAATTAATTAATTATATATATCAAAGACTTTTAA
TTAAATTTATCTTTTTAAAATTAGGTCACTGTTTAGGGTGTTTTCCTCCCTTCTGAGCAT
GATGATTACCTTTCAAGAAGCAACTTGATCATGGAAACTTTTATTGAATCCTATAAAATT
TAAAAAGAAAAGAAGAGCTATTCAGACATGCAAATTGAAGAAGATATTTAGATTAAGATT
TAAGAAATGAGAGAAGAAATGACTGATGAGTAAATTTATGAACTACTTGCTAGATCTATC
GCACCTGAAATCTATGGTCTTGAAGATGTCAAGAAAGCTCTCCTTTTACTCATGGGTAAT
TAATACATCAATAAATTATTAATTAATTAATTTGCTTGTTTGTTTATTTTGCTATTGAAA
ATTAAATATTTCTTTAAAAATAAATTAAGTTGGTGGTACCTCTTTGGAAACAAAGGACGG
CATGAGAATCAGAGGTGACATTAACATGGCTATGATTGGTGATCCTGGTGTTGCTAAGAG
TTAATTGTTAAAACACATTGCTAGAGTCTCTCCTAGAGGTATTTACACTACAGGTAAAGG
TTCCAGTGGTGTCGGTCTAACTGCTTCTTTGATTAAAGATCCCATTACTCACGAAATGTC
ATTAGAAGCTGGTGCCCTCGTCCTTGCTGATATGGGTGTCTGTTGTATTGATGAATTCGA
TAAGATGAATGAAAATGATAGAACTTCCATCCATGAAGTTATGGAATAACAAACCGTCTC
TATTGCTAAGGCAGGTATGGCTACTTCTCTCAACGCCAGAACTTCCATCCTTGCTGCTGC
CAATCCTTTATATGGAAGATATAACAAAAAGGTTTCTCCCCATAAAAACATCAACCTACC
TTATGCTCTTCTTTCAAGATTTGATTTGGTAATTTTTTCATATAATAAACTGTTTTTCAA
AATTAAATTAAAGGAATTGCGTTTGTTTTAAGATAATTAATTTAATTTATTGAATGAAAA
AATTTAAATTTAATAAAATTTTTCGATTAAACTAAATAGGTTTTCATCTTACTTGATACT
GCTTCTGAAGAAAACGATAGCAGATTAGCTAAGCACATTCTATAAGTACATAAAACATTA
TAACCTCCTAAATCAACTGAAGAAACAGTTGACGCAGCTGTGATTAAAGCTTACATCAGC
TAAGCTAAGTAGTTTTAACCTACTATCAATAAAGAACTCCATGATTTCTTAACTTCAAGA
TATTTAGAAAAAAGAAAAGCACAAAATGATAAAAGCAAAGATGGTTACAATTATACTACT
CCAAGAACTTTACTTGGTATATTGCGTCTTGCTTAAAGTTTGGCTAAATTGAGATTCTCA
GAAACTGTCTCATAAAAAGATGTAGATGAAGCCTTGAGATTAATAGAAGAATCTCAAAAA
TCTGTATAAGAAGGCTAAGATGATGGCAGTACTTAACAAAGTAATATCATTTATTTATTT
GATGATTAACTAAAATTAATTAAATTATTCTTATAAAAATAGAAATTTAAAAAGACTTCA
AATCTGAAATCTATTAAATTATCTCTAAACTGTGTCTTAAATAAAAAGATTTTATTATTT
CAGAATCTGAAGCTCTTAAATAAGTAAGATTTCTTTATCATCCTTATCTTAAAAAATAAA
ATTTTTATTTATTAATTTAAAAAGGTTTTAGCTAAAGGTTATACAAACACCTAATTTGAA
AAAACTTTAGATTACTACAATTAAATTGATCTTTTAATGGTTAACCAAGAAACTAAAAAA
ATTACCTACATAGTTACCAAGGAATGA