Identifiers and Description

Gene Model Identifier

TTHERM_01132890

Standard Name

TSG1 (Tumor Susceptibility Gene 1)

Aliases

PreTt10923 | 248.m00036

Description

ESCR-I complex subunit; homolog of human TSG101

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF05743 ) Tumour susceptibility gene 101 protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_01132890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01385.11.9998944264638884e-101hypothetical protein (750 aa)
OxytrichaContig380.1.g560.0000007001298633766835UEV domain
DictyBaseDDB_G02867970.00010003404299092957tsg101 on chromosome: 4 positi
on 4717096 to 4718707

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000136

Sequences

>TTHERM_01132890(coding)
ATGTTTAGCCCTTAGAATAATGTAGCAGCAGCCGCAGCAAATCCTTTATAAAGAAACTAA
ATGCTTTCATAGTTGTTGAGATAGTGCAATTATAATTAAATTGGCGCTCTAAACAATACA
TGCTTTTAAGTATTTAGCTCATACACTGAAATGACTCCTTGCCTTTAGACAATGAAGGTA
GGAAATACAACTTAAAATGTAATTGAACTTGTTGGAAATGTTGGCATTAAGTTGAATAAT
AACACTTATCACGTTCTTACTCATATAGTATTCCCCTTATAGTTCCCTACTTGTCCTCCT
GTTATCAGAATTAAGAACATTAATCCTGATAAATTCTGCGTTAATGCGAAATACCTACAA
AACTACACAAATGATGGCTTCATTACTCTTTATTTGTCTGAGACATAAACTTGGAATCAG
CATCAAAATATTTTAAGACTTCTATAATAAATGCAAAAAGAACTCTCAGAAGCATTCCCT
TTTTATGAGAAAAAGCAATAGTTCTAAAATGGAATGGGATAAGTATAAAGCAATCCCAAT
AGCCCTTATAACTAATATAACTACTAAAATTAATAACGTCCTCCTAGTTCATTTTAATAA
AATACTTATGTAAATTAAGGGGGTTATCAGTAAAATTAATACAATAACATGTATGGAAAC
TATTAGCAACCACCAAATCCACTATAAATCAACAATAACAATAACAATAATAATTTTGTA
GGAGGAAATCAACCTATTTACATGGGAGTAGGTTAATAGCCTTAATACGAATAGTAAGTA
GCAGTTAGATTAAAATAGGAACTTGAAGTCACATTAAAAGGAATATTAGAAGAGTTTAAT
GAAGAAAAAAAATCATCTGATCAGCTCTACAGCATTAAATAAAAGCTTGATGAAAATGAA
GTTTCTTGTAATTAGTTGGAGGAAGAAATTAGAATGAAATCAAGTTTAATCCAATAGCAA
ATTTCAATTCTTTAAGAATTTATCTCTTAAAATGATTCTGCTAGCATAAACAAGGACAAT
GTATAAAACTTCATCAAAGAATAAAATCCTTTGCAAAACTAAATTTTAGAATTAACAAGT
GAATAAGAAGCTATTAAAGAAACTATTATATATATTGAAGAAGCCTTTAAGTAAAAAAAA
ATAGATTTCGAGACATTAATCAAGTCTATTTAATACTACTCTGAATTAGAATTCAATACT
AAATTACTCTTAAAAAAATGTGTGGCAAATTATAAAAAATGA


>TTHERM_01132890(protein)
MFSPQNNVAAAAANPLQRNQMLSQLLRQCNYNQIGALNNTCFQVFSSYTEMTPCLQTMKV
GNTTQNVIELVGNVGIKLNNNTYHVLTHIVFPLQFPTCPPVIRIKNINPDKFCVNAKYLQ
NYTNDGFITLYLSETQTWNQHQNILRLLQQMQKELSEAFPFYEKKQQFQNGMGQVQSNPN
SPYNQYNYQNQQRPPSSFQQNTYVNQGGYQQNQYNNMYGNYQQPPNPLQINNNNNNNNFV
GGNQPIYMGVGQQPQYEQQVAVRLKQELEVTLKGILEEFNEEKKSSDQLYSIKQKLDENE
VSCNQLEEEIRMKSSLIQQQISILQEFISQNDSASINKDNVQNFIKEQNPLQNQILELTS
EQEAIKETIIYIEEAFKQKKIDFETLIKSIQYYSELEFNTKLLLKKCVANYKK


>TTHERM_01132890(gene)
GTGAAATTTTCTCATACTAAAAATTCTAATTAAAAGTATAGTGTAAACAAAAGTTCGCAA
TATATAGATTTTCTAAAATAAATATCCTTTATAATAAATATGTTTAGCCCTTAGAATAAT
GTAGCAGCAGCCGCAGCAAATCCTTTATAAAGAAACTAAATGCTTTCATAGTTGTTGAGA
TAGTGCAATTATAATTAAATGTAATTAATAATTTCTAGCAACTATATTAATGTTTTTTTA
TGATCTATTATAAATTATAGTGGCGCTCTAAACAATACATGCTTTTAAGTATTTAGCTCA
TACACTGAAATGACTCCTTGCCTTTAGACAATGAGTAAATAAATAAATATTATATTGTAA
GTAATTATTTAATAAACATATTATAAATAATATCAAAAGAGGTAGGAAATACAACTTAAA
ATGTAATTGAACTTGTTGGAAATGGTAAGTAGCAATTTATTTTAGATGCAACAATATTAA
CTTAAATAAATTATCATTAAAGTTGGCATTAAGTTGAATAATAACACTTATCACGTTCTT
ACTCATATAGTATTCCCCTTATAGTTCCCTACTTGTCCTCCTGTTATCAGAATTAAGAAC
ATTAATCGTAAATAAATAAATAAATAAATTCTTACTCATATATTTTGTTTAAAATAAAAA
TATTCAATCAATGAACGTAAACATAATACTTTTTATATAAAATCAGCTGATAAATTCTGC
GTTAATGCGAAATACCTACAAAACTACACAAATGATGGCTTCATTACTCTTTATTTGTCT
GAGACATAAACTTGGAATCAGCATCAAAATATTGTAAAAATTATTTCTGCTGAATTGCTT
TTTGATATTATTGAAAAAAAAAAAAACAAAATAAATTAAATTAAATTTCTTCCTTTCCAT
TTTAAAAGCAGATAAATAAATTTAAAAAAAAAAAAAATATTTTTGGACAAATGGCTATCT
ATCGCTCTTTGTCAAAAACTTTGAATAAAATGATTTCTTTTTTAAGGCAATTTTTATTAA
TTTATATTTTAATAATTGAAAAATTATTAGTTAAGACTTCTATAATAAATGCAAAAAGAA
CTCTCAGAAGCATTCCCTTTTTATGAGAAAAAGCAATAGTTCTAAAATGGAATGGGATAA
GTATAAAGCAATCCCAATAGCCCTTATAACTAATATAACTACTAAAATTAATAACGTCCT
CCTAGTTCATTTTAATAAAATACTTATGTAAATTAAGGGGGTTATCAGTAAAATTAATAC
AATAACATGTATGGAAACTATTAGCAACCACCAAATCCACTATAAATCAACAATAACAAT
AACAATAATAATTTTGTAGGAGGAAATCAACCTATTTACATGGGAGTAGGTTAATAGCCT
TAATACGAATAGTAAGTAGCAGTTAGATTAAAATAGGAACTTGAAGTCACATTAAAAGGA
ATATTAGAAGAGTTTAATGAAGAAAAAAAATCATCTGATCAGCTCTACAGCATTAAATAA
AAGCTTGATGAAAATGAAGTTTCTTGTAATTAGTTGGAGGAAGAAATTAGAATGAAATCA
AGTTTAATCCAATAGCAAATTTCAATTCTTTAAGAATTTATCTCTTAAAATGATTCTGCT
AGCATAAACAAGGACAATGTATAAAACTTCATCAAAGAATAAAATCCTTTGCAAAACTAG
TAAATATTTAGAAAAAATAAATCAAAATTCAATCTAATTCTATTTTTAAAAACAGAATTT
TAGAATTAACAAGTGAATAAGAAGCTATTAAAGAAACTATTATATATATTGAAGAAGCCT
TTAAGTAAAAAAAAATAGATTTCGAGACATTAATCAAGGTAAAATTATTAATAAATATAA
TCTCATAATAAGTTTTTTAACTTAAAAATAATTAGTCTATTTAATACTACTCTGAATTAG
AATTCAATACTAAATTACTCTTAAAAAAATGTGTGGCAAATTATAAAAAATGA