Identifiers and Description

Gene Model Identifier

TTHERM_00194650

Standard Name

TRS1 (Threonyl-tRNA synthetase 1)

Aliases

PreTt06749 | 16.m00405

Description

threonyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00194650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_318130
WormBaseWBGene000066179.997093137033517e-262locus:tars-1 status:Confirme
d UniProt:Q86D21 protein_i
d:CAD89723.1
Tetrahymena borealisEI9_03737.19.997093137033517e-262threonyl-tRNA synthetase (942
aa)
DictyBaseDDB_G02882679.997093137033517e-262thrS1 on chromosome: 5 positio
n 1320046 to 1322570
OxytrichaContig22136.0.g269.997093137033517e-262tRNA synthetase class II core
domain (G, H, P, S and T)
SGDYIL078W9.997093137033517e-262THS1 Threonyl-tRNA synthetase,
essential cytoplasmic protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00194650(coding)
ATGTTAATTAAATAAATTGCAAACTATTACTTAAGGAGACCTTAATCCGCAAGATATTTT
ACGAGTACCAGAAAACTAGCTAAATTATCGTTTAATTCATAGAACTTTTTTCATCAGCAA
AATAATTTAGAAAATAACTTCTTAGAAGAAAAAATAGAACATTGTCATTAAGTAGCAAAT
AGAATCATGACTGACTTAGGAACTAAAACCAAATTCACTGAAGGTAGCATTTAAGAGCCT
AACCAAGGTAAGATTGGTGGCGAATTCGTTAAGCAATAAAACCCTGCCTTCCTTGACGAA
AGACTTAAGTACTTCGATGCCATCTATGCTGAATAGCAATAAATTCTTGCCAAGGCCGAA
AAGCCTGAAATTACCGTCACTCTTAAGGATGGCAAGACTATTCCTGGTAAGGCTTTTGAA
ACTACTCCTTCCCATATTGCAAAGTCAATCTTCAAGAAGGTCCCTGAAAAGTTTGTAGGT
GCAAAGATTGTCTACAGCAAGAAATACGAAAGTGAATTGACCAAGATTGGTGAATACGTT
GATGCTGAAGCTGAAGAAGTAGCTGAAGAAGGTGGAGATTGCTGCGGTGGCCACGGCGAA
TAAAAGTTTGAAGTTTACGATCTTGAAAGACCTCTCGAAGGTGACTGTACTCTTGAGCTC
ATCGACTTCGAATGCCAAGAAGGAAGAGAAGTTTTCTGGCACAGCTCTGCTCACATGTTA
GGTCAAGCTTTAGAATTAAATTACGGTGTTCACTTATGTATTGGACCTCCTTTGGCTAAT
GGTTTCTTCTATGATTCTTACATGGGTAACGAAAAGATTTCCCAAGATAACTTTGCTGAA
ATCGAAAAGACCTTCGCTAAGGTAGCTTCTGAAAAGCAACCCTTCTAAAGAGTTATTTTA
ACCAAGAAGTAAGCTTTAGAATTATTCAAGCATAACCCCTTCAAGGTTTAATTGATCACC
AACAAGATTCCTGATAACGCTATCACCACTGCTTACAAGTGTGGTAAGTTGATCGATTTA
TGTACTGGTCCTCACTTACCCCACACTGGTTATGTTAAGGCCTTTAAGGTTGAAAAGAAC
TCTGCTGCTTACTGGCTCGGTAAGAACACTAACGATGGTTTACAAAGAGTTTATGGTATT
GCTTTCCCTTCAAAGAAAGAACTCGATGCTCACGTCTTAAGACAAGAAGAACTTGCTAAG
AGAGATCACAGAAATATCGGTAAGCAATAAGAATTGTTCACTTTCCACCAATTCTCTCCT
GGTTGTGCTTTCTTCTATCCTAATGGTGCTCACATCTACAACAAGTTGATGGAAGTCTTA
CGTAAATAATACAAAATTAGAGGATACTCTGAGGTTATTACTCCTAACCTCTTCGATGCC
TAACTTTGGAAAATCTCTGGTCATTGGGACAAGTATAAAGAAAATATGTTCCTTCTCAAG
AATGATAATGAAGAACACGGATTCAAGCCTATGAACTGTCCTGCTCACTGTCTTATGTTC
GATTCTATTCAAAGATCTTACAGAGATCTTCCCTTGAGATATGCTGACTTTGGTGTCCTT
CACAGAAACGAAGTCCACGGTGCCCTCTCTGGTCTCACCAGAGTTAGACGTTTCTAACAA
GATGATGCTCACATCTTCTGTACTATGGATCAAATTATGGAAGAAATCAAGAATGCTTTA
GATTTTATCGATTACATGTACAGCTTATTTGGTTTCAAGTACAGCCTTGCTCTCTCCACC
AGACCTGATAACTATATTGGTGAAATCGAAATGTGGGATTAAGCTGAAAATGCTCTTAAG
AAAGGTCTTGAAGCTTTTGGAAAACCCTGGGCTATTAAGGCCAAGGATGGTGCTTTCTAT
GGTCCTAAAATTGATATCTAATTATATGATGCCTTTGACAGAGGTCACTAATGCGGAACC
ATTCAATTAGATTTCAACTTACCTATCAGATTTAACCTCTAATACAGAGCCCCTGAAAAC
AAGGATGACATTGAAAAGTAAAGAAAGAAACAAGAATCTACTGAAGAAAGCGTTCCTCTT
TCATAAGAAGAAAAGAAAAAATTAGAATAACAAATTTCTGAAGGTGAATCTGCTGACTCT
CTTTCTCACAAGAAGTCAAAGAAATCCACTGACTCCTCAGCTTAATCCTAAGCTTCTGAA
AAGAAATACGTTGTTGCTCCTCATCACTTGAAGCTTGGTTTCTAAAGACCTGTTATCTTG
CACAGAGCTGTCATCGGTTCTTTCGAAAGATTCTTGGCTATTTTGTGTGAATAAACTGCT
GGTAAGTGGCCTTTCTGGTTATCTCCCAAGCAATTAATTATCTGCCCTATTACTGCTAAG
GTTAACGATTTCGCCCAAGATGTTGCTGATCGTTTGAAAGTTGAAGGTTACAAGGTTGCT
GTCGACCTTTCTGAAAGCACCATCCAAAAGAAGGTTAGAAACGCTCAATTAGAACAATAT
AACTACATTGCTGTTGTTGGTGAAGAAGAAAAGAGAGGAGGCTATGTTGATTTAAGAGCC
AGAGATACCACCAAGGATCAAGAAAGAATGGTAATTTATTTCTTTTTCCCATTTTAATTT
AATATTTAAAAATATTTTTTTGTTTATTTTAGGGTAAATTCACTATTCACTAACTCTTTG
CTCTCTTCTAATCCTAAGAACCCCACAAATCTTCAGCTGAAGTCAAGCTTATGGAAAGAA
TCCAACACATTAATGGTAATCCTTAACATGCTGCTCTTGAAGAAGAATTAAAGACCAAGA
TGTTCTTAGAAGGAGATGGTTTTGCTTTAGGTGCTAGAGATAAAGAAGTTTATGAAAGCC
TTAAGAGCTCTCACATTGATAATGTATCTTATCCTAATCTCCACAAGTGGTTCTAATATT
TATCAAAGCAAGCTTGATATATAAAAAATTGAATTTATTCATAAAAAATAATAAAATTAC
TTATTCTTATACCTATATGAAATATATAATGTAGTTCACAATTTAGATTTCTTAATATTT
AATTTACACTTTTAACTCTAATTGTTTGTTACTTATTATTCTAATTTATTTTTAATTCTA
TTTCATGATAATTTATTTTTTGTTGAAAATAAAAGAGTTATCTTGGATTGTTCAAATTTT
TAATTAATTTATGTTAATTTTTTAATTATTCATACATGCTAATTTTATTATTTTAATTTA
TATTTTCATTTTTAAATCTAAAAAATTAATTAAATTTTTATTTTTTTAAATTCCATTTCT
GAACAATATAAAATAATTATCAATATGTAAAACAAACAAGTTATTCGATATATTTTATAG
TCTTATTCATTCATTTATTTATTTATTTATTCATTTAATCTAAAATATTCTTGA


>TTHERM_00194650(protein)
MLIKQIANYYLRRPQSARYFTSTRKLAKLSFNSQNFFHQQNNLENNFLEEKIEHCHQVAN
RIMTDLGTKTKFTEGSIQEPNQGKIGGEFVKQQNPAFLDERLKYFDAIYAEQQQILAKAE
KPEITVTLKDGKTIPGKAFETTPSHIAKSIFKKVPEKFVGAKIVYSKKYESELTKIGEYV
DAEAEEVAEEGGDCCGGHGEQKFEVYDLERPLEGDCTLELIDFECQEGREVFWHSSAHML
GQALELNYGVHLCIGPPLANGFFYDSYMGNEKISQDNFAEIEKTFAKVASEKQPFQRVIL
TKKQALELFKHNPFKVQLITNKIPDNAITTAYKCGKLIDLCTGPHLPHTGYVKAFKVEKN
SAAYWLGKNTNDGLQRVYGIAFPSKKELDAHVLRQEELAKRDHRNIGKQQELFTFHQFSP
GCAFFYPNGAHIYNKLMEVLRKQYKIRGYSEVITPNLFDAQLWKISGHWDKYKENMFLLK
NDNEEHGFKPMNCPAHCLMFDSIQRSYRDLPLRYADFGVLHRNEVHGALSGLTRVRRFQQ
DDAHIFCTMDQIMEEIKNALDFIDYMYSLFGFKYSLALSTRPDNYIGEIEMWDQAENALK
KGLEAFGKPWAIKAKDGAFYGPKIDIQLYDAFDRGHQCGTIQLDFNLPIRFNLQYRAPEN
KDDIEKQRKKQESTEESVPLSQEEKKKLEQQISEGESADSLSHKKSKKSTDSSAQSQASE
KKYVVAPHHLKLGFQRPVILHRAVIGSFERFLAILCEQTAGKWPFWLSPKQLIICPITAK
VNDFAQDVADRLKVEGYKVAVDLSESTIQKKVRNAQLEQYNYIAVVGEEEKRGGYVDLRA
RDTTKDQERMVIYFFFPFQFNIQKYFFVYFRVNSLFTNSLLSSNPKNPTNLQLKSSLWKE
SNTLMVILNMLLLKKNQRPRCSQKEMVLLQVLEIKKFMKALRALTLIMYLILISTSGSNI
YQSKLDIQKIEFIHKKQQNYLFLYLYEIYNVVHNLDFLIFNLHFQLQLFVTYYSNLFLIL
FHDNLFFVENKRVILDCSNFQLIYVNFLIIHTCQFYYFNLYFHFQIQKINQIFIFLNSIS
EQYKIIINMQNKQVIRYILQSYSFIYLFIYSFNLKYS


>TTHERM_00194650(gene)
ATGTTAATTAAATAAATTGCAAACTATTACTTAAGGAGACCTTAATCCGCAAGATATTTT
ACGAGTACCAGAAAACTAGCTAAATTATCGTTTAATTCATAGAACTTTTTTCATCAGCAA
AATAATTTAGAAAATAACTTCTTAGAAGAAAAAATAGAACATTGTCATTAAGTAGCAAAT
AGAATCATGACTGACTTAGGAACTAAAACCAAATTCACTGAAGGTAGCATTTAAGAGCCT
AACCAAGGTAAGATTGGTGGCGAATTCGTTAAGCAATAAAACCCTGCCTTCCTTGACGAA
AGACTTAAGTACTTCGATGCCATCTATGCTGAATAGCAATAAATTCTTGCCAAGGCCGAA
AAGCCTGAAATTACCGTCACTCTTAAGGATGGCAAGACTATTCCTGGTAAGGCTTTTGAA
ACTACTCCTTCCCATATTGCAAAGTCAATCTTCAAGAAGGTCCCTGAAAAGTTTGTAGGT
GCAAAGATTGTCTACAGCAAGAAATACGAAAGTGAATTGACCAAGATTGGTGAATACGTT
GATGCTGAAGCTGAAGAAGTAGCTGAAGAAGGTGGAGATTGCTGCGGTGGCCACGGCGAA
TAAAAGTTTGAAGTTTACGATCTTGAAAGACCTCTCGAAGGTGACTGTACTCTTGAGCTC
ATCGACTTCGAATGCCAAGAAGGAAGAGAAGTAATACAAACAAACATTATTTTTGAAAAC
AATTTAGACACTTTTTCTCCATTCTAAATTAGTATTTTTGAAAGACACAAAAAGCAAATA
AAATAAACAAAAATATAAGAAATTATTTAATAATAGCATTTATAAATATGCCCGAAAGCT
GGCCTTTCCTAGTTGAACCAGTTTAGTTCAATAAAAAAAATAATTTTAGTTTAGACAAAA
AAAAAATTTATTTAACTCAGATAAATAAACAAACAAACAAACATCTACAACAGAATGTTA
TTAATTTAAAAAAATAAACCAAAAATTAATAATTAATACAATCCTTAAATGATTTCAAAA
GATGCTTATTAATTTGACTTTTATTCTCTTTTAATAATTTTAATCTAAATGGGTTTGTTT
CTTTGAATTTAACAAAAAATAATGTAAACAAAATATATTTTCGTAAATCCCAAGTAAAAT
ATTTTAATTCAAATTAGTGAAAAGGGCGTTTTAATAACTTCAAAGCTTTCTTTCTTTGAA
AATATCTTTTAATTTTTTTGCATCTTTAACCTAAATTTTGCATCACTCTTTAATTTTTAA
CAGATGCTACGTCACTCACTTAATACTTATTATAGATTTTTACATCTTATTTTCTAAAAA
TTCTCCTTTTCTTCTTTTTAAATTTTCTTTTAATTATTTGAAAGGTTTTCTGGCACAGCT
CTGCTCACATGTTAGGTCAAGCTTTAGAATTAAATTACGGTGTTCACTTATGTATTGGAC
CTCCTTTGGCTAATGGTTTCTTCTATGATTCTTACATGGGTAACGAAAAGATTTCCCAAG
ATAACTTTGCTGAAATCGAAAAGACCTTCGCTAAGGTAGCTTCTGAAAAGCAACCCTTCT
AAAGAGTTATTTTAACCAAGAAGTAAGCTTTAGAATTATTCAAGCATAACCCCTTCAAGG
TTTAATTGATCACCAACAAGATTCCTGATAACGCTATCACCACTGCTTACAAGTGTGGTA
AGTTGATCGATTTATGTACTGGTCCTCACTTACCCCACACTGGTTATGTTAAGGCCTTTA
AGGTTGAAAAGAACTCTGCTGCTTACTGGCTCGGTAAGAACACTAACGATGGTTTACAAA
GAGTTTATGGTATTGCTTTCCCTTCAAAGAAAGAACTCGATGCTCACGTCTTAAGACAAG
AAGAACTTGCTAAGAGAGATCACAGAAATATCGGTAAGCAATAAGAATTGTTCACTTTCC
ACCAATTCTCTCCTGGTTGTGCTTTCTTCTATCCTAATGGTGCTCACATCTACAACAAGT
TGATGGAAGTCTTACGTAAATAATACAAAATTAGAGGATACTCTGAGGTTATTACTCCTA
ACCTCTTCGATGCCTAACTTTGGAAAATCTCTGGTCATTGGGACAAGTATAAAGAAAATA
TGTTCCTTCTCAAGAATGATAATGAAGAACACGGATTCAAGCCTATGAACTGTCCTGCTC
ACTGTCTTATGTTCGATTCTATTCAAAGATCTTACAGAGATCTTCCCTTGAGATATGCTG
ACTTTGGTGTCCTTCACAGAAACGAAGTCCACGGTGCCCTCTCTGGTCTCACCAGAGTTA
GACGTTTCTAACAAGATGATGCTCACATCTTCTGTACTATGGATCAAATTATGGTAAATA
TTGAATTAAACTTACTTGATAAAACAAAAAATAAAAAATATTTTTTTTTATCAAAAATTT
TAGGAAGAAATCAAGAATGCTTTAGATTTTATCGATTACATGTACAGCTTATTTGGTTTC
AAGTACAGCCTTGCTCTCTCCACCAGACCTGATAACTATATTGGTGAAATCGAAATGTGG
GATTAAGCTGAAAATGCTCTTAAGAAAGGTCTTGAAGCTTTTGGAAAACCCTGGGCTATT
AAGGCCAAGGATGGTGCTTTCTATGGTCCTAAAATTGATATCTAATTATATGATGCCTTT
GACAGAGGTCACTAATGCGGAACCATTCAATTAGATTTCAACTTACCTATCAGATTTAAC
CTCTAATACAGAGCCCCTGAAAACAAGGATGACATTGAAAAGTAAAGAAAGAAACAAGAA
TCTACTGAAGAAAGCGTTCCTCTTTCATAAGAAGAAAAGAAAAAATTAGAATAACAAATT
TCTGAAGGTGAATCTGCTGACTCTCTTTCTCACAAGAAGTCAAAGAAATCCACTGACTCC
TCAGCTTAATCCTAAGCTTCTGGTATTTAAAATTTATAGTTAACAAAATTTTAACAAACT
AAATTTAACCAATTTTATAGAAAAGAAATACGTTGTTGCTCCTCATCACTTGAAGCTTGG
TTTCTAAAGACCTGTTATCTTGCACAGAGCTGTCATCGGTTCTTTCGAAAGATTCTTGGC
TATTTTGTGTGAATAAACTGCTGGTAAGTGGCCTTTCTGGTTATCTCCCAAGCAATTAAT
TATCTGCCCTATTACTGCTAAGGTTAACGATTTCGCCCAAGATGTTGCTGATCGTTTGAA
AGTTGAAGGTTACAAGGTTGCTGTCGACCTTTCTGAAAGCACCATCCAAAAGAAGGTTAG
AAACGCTCAATTAGAACAATATAACTACATTGCTGTTGTTGGTGAAGAAGAAAAGAGAGG
AGGCTATGTTGATTTAAGAGCCAGAGATACCACCAAGGATCAAGAAAGAATGGTAATTTA
TTTCTTTTTCCCATTTTAATTTAATATTTAAAAATATTTTTTTGTTTATTTTAGGGTAAA
TTCACTATTCACTAACTCTTTGCTCTCTTCTAATCCTAAGAACCCCACAAATCTTCAGCT
GAAGTCAAGCTTATGGAAAGAATCCAACACATTAATGTAATTAAAATCTCCATCATATTT
ATATTTAAATAAAAATAAAATATAGGGTAATCCTTAACATGCTGCTCTTGAAGAAGAATT
AAAGACCAAGATGTTCTTAGAAGGAGATGGTTTTGCTTTAGGTGCTAGAGATAAAGAAGT
TTATGAAAGCCTTAAGAGCTCTCACATTGATAATGTATCTTATCCTAATCTCCACAAGTG
GTTCTAATATTTATCAAAGCAAGCTTGATATATAAAAAATTGAATTTATTCATAAAAAAT
AATAAAATTACTTATTCTTATACCTATATGAAATATATAATGTAGTTCACAATTTAGATT
TCTTAATATTTAATTTACACTTTTAACTCTAATTGTTTGTTACTTATTATTCTAATTTAT
TTTTAATTCTATTTCATGATAATTTATTTTTTGTTGAAAATAAAAGAGTTATCTTGGATT
GTTCAAATTTTTAATTAATTTATGTTAATTTTTTAATTATTCATACATGCTAATTTTATT
ATTTTAATTTATATTTTCATTTTTAAATCTAAAAAATTAATTAAATTTTTATTTTTTTAA
ATTCCATTTCTGAACAATATAAAATAATTATCAATATGTAAAACAAACAAGTTATTCGAT
ATATTTTATAGTCTTATTCATTCATTTATTTATTTATTTATTCATTTAATCTAAAATATT
CTTGA