Identifiers and Description

Gene Model Identifier

TTHERM_01143900

Standard Name

TRM9 (tRNA methyltransferase9)

Aliases

PreTt01404 | 253.m00029

Description

tRNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08241 ) methyltransferase domain
  • ( PF08242 ) methyltransferase domain
  • ( PF02390 ) Putative methyltransferase
  • ( TIGR00740 ) methyltransferase, putative
  • ( PF01209 ) methyltransferase, UbiE/COQ5 family
  • ( PF07021 ) methionine biosynthesis protein MetW
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein
  • ( TIGR01934 ) ubiquinone/menaquinone biosynthesis methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20%

TetraMine Data

TTHERM_01143900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19314.19.997093137033517e-262hypothetical protein (686 aa)
OxytrichaContig4316.0.g1052.9985100291019436e-1132OG-Fe(II) oxygenase superfami
ly
WormBaseWBGene000075812.0008958828286524e-54locus:alkb-8 status:Confirme
d UniProt:Q9U3P9 protein_i
d:CAB63431.2
SGDYML014W6.000481660141652e-51TRM9 tRNA methyltransferase, c
atalyzes esterification of mod
ified uridine nucleotides in t
RNA(Arg3) and tRNA(Glu), likel
y as part of a complex with Tr
m112p; deletion confers resist
ance to zymocin
DictyBaseDDB_G02924489.996696112986116e-50DDB_G0292448 on chromosome: 6
position 1659633 to 1660676
Stentor CoeruleusSteCoe_287895.900090541597061e-29

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01143900(coding)
ATGAAAGATTTACAACTATTATTTTATTTACAAAGAATCAAATCAATTTTTATTTAATTC
TACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGATACCCACTCTCCT
TTCGAAGAAAAAATTGTTATTGTTTCTTTGAATTCTGGAGTAGTTATGTCCTTCAAAAGC
TATAAAAATGAAGAAAAACACCTCTTCCTTCCTCCTCGCTCTATTCTTGTTTTAAGTGAT
GAAGTTAGATACGCCTGGTTCCATAGTATTGCAAGTAGAAAGGTAGATAAGGTAGAAGGG
GACTTTAATTTCCGTAGAAGAAGAGTTTCTCTCACATTTAGAACTGTATAGTTCAAACCA
TGTAGATGTGCTTATCCATTCTTTTGTGAGGATCAAGGATATGACCCAGTTACAATGAAA
AAAAATAATCCCCTTCTTCCTAGAGATTACCATGCTAAAGATGACTCAACAAAGGTCGTA
GCTCCTAAAAGTGAAGAAGAATAAAAAATTTTAGACGAAGTTTAATAAGTAAATACTGAT
GGCAAGCCAACAAATTTAGAACAAAAGTATGTCTATGAAGTTTATGAGAAAATTGCTCCT
CATTTCTCACATACCAGATACAATCCTTGGCCTAAAATTGAAAGCTTCTTAAAAGGATTA
GAACCTGGTTCATTAGTTGCTGATATTGGTTGTGGAAATGGCAAATATTTAGATTGCCAC
AATGGAGATATTTACATGATAGGAACAGACAGAAGTGAAAATTTAATATCTTTAGCTAGA
AACAGAGGTGAGGATATTTAGGTATTTAGTGCTGATTCTCTTAAGCTTCCATGGTTGAGC
TCAAAGTTCGATAATGCTATTTCAATAGCCGTTATTCATCATTTTTCAACCCCAGAATTA
AGAATACATGCTATAAAGGAAATCTTAAGAATTTTAAGAGTTGGAGGAGAGGCTCTTATT
TATGTTTGGGCATTTGAATAAACTGAAAAAAGTTTCTCAGAATAAGATGTGTTTGTGCCA
TGGAATTTATAGAATAAATATGAAGACGAAAAAGTAGTCAAAGGAGAAGTTAAACCCAAC
ACAGATATTTAAATTAATGAAGCCAAGCAAAGTGTTGTTTACAAAAGATATTATCATGTA
TTCAAAAAAGGTGAATTAGAAGAACTTATTTCAAGAATACCTAATTGCAAGATAAATGAT
AGCTATTACGATCATGCAAACTGGGCTGTTAAAATTCAAAAGACTTCAGAGTGA


>TTHERM_01143900(protein)
MKDLQLLFYLQRIKSIFIQFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTHSP
FEEKIVIVSLNSGVVMSFKSYKNEEKHLFLPPRSILVLSDEVRYAWFHSIASRKVDKVEG
DFNFRRRRVSLTFRTVQFKPCRCAYPFFCEDQGYDPVTMKKNNPLLPRDYHAKDDSTKVV
APKSEEEQKILDEVQQVNTDGKPTNLEQKYVYEVYEKIAPHFSHTRYNPWPKIESFLKGL
EPGSLVADIGCGNGKYLDCHNGDIYMIGTDRSENLISLARNRGEDIQVFSADSLKLPWLS
SKFDNAISIAVIHHFSTPELRIHAIKEILRILRVGGEALIYVWAFEQTEKSFSEQDVFVP
WNLQNKYEDEKVVKGEVKPNTDIQINEAKQSVVYKRYYHVFKKGELEELISRIPNCKIND
SYYDHANWAVKIQKTSE


>TTHERM_01143900(gene)
ATGAAAGATTTACAACTATTATTTTATTTACAAAGAATCAAATCAATTTTTATTTAATTC
TACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGATACCCACTCTCCT
TTCGAAGAAAAAATTGTTATTGTTTCTTTGAATTCTGGAGTAGTTATGTCCTTCAAAAGC
TATAAAAATGAAGAAAAACACCTCTTCCTTCCTCCTCGCTCTATTCTTGTTTTAAGTGAT
GAAGTTAGATACGCCTGGTTCCATAGTATTGCAAGTAGAAAGGTAGATAAGGTAGAAGGG
GACTTTAATTTCCGTAGAAGAAGAGTTTCTCTCACATTTAGAACTGTATAGTTCAAACCA
TGTAGATGTGCTTATCCATTCTTTTGTGAGGATCAAGGATATGACCCAGTTACAATGAAA
AAAAATAATCCCCTTCTTCCTAGAGATTACCATGCTAAAGATGACTCAACAAAGGTCGTA
GCTCCTAAAAGTGAAGAAGAATAAAAAATTTTAGACGAAGTTTAATAAGTAAATACTGAT
GGCAAGCCAACAAATTTAGAACAAAAGTATGTCTATGAAGTTTATGAGAAAATTGCTCCT
CATTTCTCACATACCAGATACAATCCTTGGCCTAAAATTGAAAGCTTCTTAAAAGGATTA
GAACCTGGTTCATTAGTTGCTGATATTGGTAAAATCAATTTAATTTATTATAAAATAAAT
AATATTTTTCAAATTATTAAAGGTTGTGGAAATGGCAAATATTTAGATTGCCACAATGGA
GATATTTACATGATAGGAACAGACAGAAGTGAAAATTTAATATCTTTAGCTAGAAACAGA
GGTGAGGATATTTAGGTATTTAGTGCTGATTCTCTTAAGCTTCCATGGTTGAGCTCAAAG
TTCGATAATGCTATTTCAATAGCCGTTATTCATCATTTTTCAACCCCGTAAATATAAATA
AAAATATATTCTAGATAAAAGAAATAAATATTTAAATTAATTAAATAGAGAATTAAGAAT
ACATGCTATAAAGGAAATCTTAAGAATTTTAAGAGTTGGAGGAGAGGCTCTTATTTATGT
TTGGGCATTTGAATAAACTGAAAAAAGTTTCTCAGAATAAGATGTGTTTGTGCCATGGAA
TTTATAGAATAAATATGAAGACGAAAAAGTAGTCAAAGGAGAAGTTAAACCCAACACAGA
TATTTAAATTAATGAAGCCAAGCAAAGTGTTGTTTACAAAAGATATTATCATGTATTCAA
AAAAGGTGAATTAGAAGAACTTATTTCAAGAATACCTAATTGCAAGATAAATGATAGCTA
TTACGATCATGCAAACTGGGCTGTTAAAATTCAAAAGACTTCAGAGTGA