Identifiers and Description

Gene Model Identifier

TTHERM_00621400

Standard Name

TRM8 (tRNA methyltransferase 8)

Aliases

PreTt05137 | 86.m00169

Description

tRNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08241 ) methyltransferase domain
  • ( PF02390 ) Putative methyltransferase
  • ( TIGR00091 ) tRNA (guanine-N(7)-)-methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00621400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_224830
Tetrahymena borealisEI9_03047.19.997093137033517e-262methyltransferase (294 aa)
OxytrichaContig15740.0.g815.99792543404391e-93Putative methyltransferase
SGDYDL201W2.0007889996237956e-71TRM8 Subunit of a tRNA methylt
ransferase complex composed of
Trm8p and Trm82p that catalyz
es 7-methylguanosine modificat
ion of tRNA
WormBaseWBGene000122059.002853679489518e-71tRNA (guanine-N(7)-)-methyltra
nsferase status:Confirmed
UniProt:Q23126 protein_id:CA
A91400.1
DictyBaseDDB_G02764915.9981191891941984e-64mettl1 on chromosome: 2 positi
on 6855520 to 6856461

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00621400(coding)
ATGGAATAGGAAAGCAATAACAAAAATAATAATAACCACATTGAAGATGAGGATAATGAA
AAGCCTGACCATTCAGAGCTAGAATAATCATCAACAATTTAGAAAAAGTAAAGATTGATG
CCAAAAAGAGGTGAATATAGAATGCGTGCACATATTAACCCTTTAAATGATACTCCATTC
CCTTATCCTTTAAATCCTGATTATGTAAACTGGAAAATTCACTATCCTAAGTTCTTTGAT
GGAACAGATGAAGAAAATTAGAAAGTATTTTGCAACACAAATGAACATCCCTAAACTTAT
GATGAGGAAGTTAATTCTCTTTATAATGGCTTGTAAGGAGCTTAGCCAGTTTTTCTAGAT
ATTGGATGTGGTTTTGGTGGATTAGTTTTCAATTTAGCCAAAAATTTCCCTGAAAAGCTC
GTTTTGGGTCTTGAAATTAGAGACAAATTAGTCAATTACGTTTCTGAAAAAATCAAGGCT
CTTCGTATTGAAAGTCCTGACCACAAATACAATAATGCTGCTTGTATCAGAACAAATGCT
ATGAGACATATTATATAGTATTTCAGAAAGGGCACTATTGAAAAAATGTTCTTCTGCTTC
GCCGATCCCCATTTTAAGAAGTCTAACCACAGAAGAAGAATCATTAACACAGGTTTCCTT
TCTGAATATGCTTTCTTACTCAAGCCCAAAGGTAGAATTTATTGTATCACTGATGTAGAA
GATCTACATAATTGGTAAGAAGAGCATCTTGCTAAACACAGAATGTTTAGAAAGTTATCT
GAAGAAGAGCTTGTAGGAGATATATGTGTATAATTAATTTAAGATTCCACTGAAGAAGGA
TAAAAAGTTACTCGTAATGGAGGCAAAAAGTGGACCTGTGTTTTTGAAAGAGTTTGA


>TTHERM_00621400(protein)
MEQESNNKNNNNHIEDEDNEKPDHSELEQSSTIQKKQRLMPKRGEYRMRAHINPLNDTPF
PYPLNPDYVNWKIHYPKFFDGTDEENQKVFCNTNEHPQTYDEEVNSLYNGLQGAQPVFLD
IGCGFGGLVFNLAKNFPEKLVLGLEIRDKLVNYVSEKIKALRIESPDHKYNNAACIRTNA
MRHIIQYFRKGTIEKMFFCFADPHFKKSNHRRRIINTGFLSEYAFLLKPKGRIYCITDVE
DLHNWQEEHLAKHRMFRKLSEEELVGDICVQLIQDSTEEGQKVTRNGGKKWTCVFERV


>TTHERM_00621400(gene)
ATGGAATAGGAAAGCAATAACAAAAATAATAATAACCACATTGAAGATGAGGATAATGAA
AAGCCTGACCATTCAGAGCTAGAATAATCATCAACAATTTAGAAAAAGTAAAGATTGATG
CCAAAAAGAGGTGAATATAGAATGCGTGCACATATTAACCCTTTAAATGATACTCCATTC
CCTTATCCTTTAAATCCTGATTATGTAAACTGGAAAATTCACTATCCTAAGTTCTTTGAT
GGAACAGATGAAGAAAATTAGAAAGTATTTTGCAACACAAATGAACATCCCTAAACTTAT
GATGAGGAAGTTAATTCTCTTTATAATGGCTTGTAAGGAGCTTAGCCAGTTTTTCTAGAT
ATTGGATGTGGTTTTGGTGGATTAGTTTTCAATTTAGCCAAAAATTTCCCTGAAAAGCTC
GTTTTGGGTCTTGAAATTAGAGACAAATTAGTCAATTACGTTTCTGAAAAAATCAAGGCT
CTTCGTATTGAAAGTCCTGACCACAAATACAATAATGCTGCTTGTATCAGAACAAATGCT
ATGAGGTAAAAGATGAATTATTTTTGTTTAAAAATATTAAATAGAGTAAAATAAAATAGA
ACTAAAGCGTCTCGTTTGTTTTTTTGCTTGAATGATTAATTATTTTTTAATATTAGATTC
CAAGCAAATTAATTCTTCCTTTAATAAATTCACATTTATATCTGCTTAAATTTATATGGA
TAATAAATCATTTTTTGAAAATAAATAGACATATTATATAGTATTTCAGAAAGGGCACTA
TTGAAAAAATGTTCTTCTGCTTCGCCGATCCCCATTTTAAGAAGTCTAACCACAGAAGAA
GAATCATTAACACAGGTTTCCTTTCTGAATATGCTTTCTTACTCAAGCCCAAAGGTAGAA
TTTATTGTATCACTGATGTAGAAGATCTACATAATTGGTAAGAAGAGCATCTTGCTAAAC
ACAGAATGTTTAGAAAGTTATCTGAAGAAGAGCTTGTAGGAGATATATGTGTATAATTAA
TTTAAGATTCCACTGAAGAAGGATAAAAAGTTACTCGTAATGGAGGCAAAAAGTGGACCT
GTGTTTTTGAAAGAGTTTGA