Identifiers and Description

Gene Model Identifier

TTHERM_00684460

Standard Name

TRM7 (TRNA Methyltransferase 7)

Aliases

PreTt18159 | 104.m00091 | 3732.m00005

Description

tRNA m(1)G methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01746 ) tRNA (guanine-N1)-methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00684460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17334.12.0007864815129413e-165tRNA m(1)G methyltransferase (
414 aa)
OxytrichaContig4343.0.g466.999359373303508e-39tRNA synthetases class I (W an
d Y)
DictyBaseDDB_G02740733.998693556225637e-29DDB_G0274073 on chromosome: 2
position 3737258 to 3738394
SGDYOL093W1.000382677035467e-28TRM10 tRNA methyltransferase,
methylates the N-1 position of
guanosine in tRNAs
WormBaseWBGene000091313.999672240330216e-26status:Confirmed UniProt:A5J
YS8 protein_id:CAN86601.1
Stentor CoeruleusSteCoe_3602.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00684460(coding)
ATGAGCGAGTAACCTCTGTAGCAAGTTTAGCCATAATAAAATTTAGACTAAAATAATGAT
GATTTAATTGATTCAAAGATAGATTAAAACAATGCCGATTTATAGAATTAAAATGATTTC
GATCCTATAGAAGATGAAAATGATATAAATGAAAGTGACAGTAATGAAAATAATAGTTAA
AACAATTTATAAGAAGAGTAAAAATCAGAAAACTAAGTAGAAGACAACAATTAAAAGTTA
TCAAAAAATGAAATGAAAAGATAAAAGCGTGCAGAGATGTGGGAATCAATAAAGAAGAAG
AAGAAAGAGCTAAAAAAGTAAGAAAAAGAAAAGAAGAAATTAGAAAGATAGCAATAACAT
ATTGAAAACTCAAAAAATTAAGAAGAAGTAATTTAGTAGAAATAGCAGCATAAAGAACCT
TATAAATCTAATTAATAACTAAGGGATGAGTACTCTAATAGAGCAAAGAATGGTTAGCCT
ATTATTTTGGATATGTAATTTTTAGATATGTTAGAAGATAAAGAATTTAAAAGTTTAGTG
AAATAATTATGTTACATGTAATCATCTAACAAAAAGGCTGAAAAACCTTGTAGATTTATA
ATATCATCTGTAAGCCCTAAACTTAGATAAGCCCTCAATGCAAATAATGCAGATAAGTGG
GGTATTGAAATACTAGATCAGCACTATTTAGATTTATTTCCAAAGGATAATTTAGTCTAT
TTGACTGGTGATACAGACCAAGATTTAGATGAGTTAGACTAATAATGTGCTTATATAATT
GGTGGACTTGTAGATCATAATAGATTAAAAAATGTAACTTTGAATGCTGCCACGGAATAA
GGAATTCAAGTAAAGAGATTCCCAATTTAAAATCATTTAAAACTAGAAGCCTCAAGTATA
CTTGCATGCAACCACGTTTTTGATATTATGGTCCAAAGAGCTAATGGAAAAAGTTGGAAG
GAAAGTTTATAAACTGGAATTCCTATACGTAAAGTAGTTGCCTTGATAGAAAATGGAGTA
GAAATCCCTACAGAGCACTATTTAAAAAAGTTAGAATAAATGAAAAAATAGTAATAGATT
GCTTTAGAAAAGAAAAAGCTCTAAGAATAATCTTAGGAATTTATTAAAGATAGCTAAAAA
GCTTCAACATATAATGAAATTAAAGAAACTGATTTAAAAGAATCTGATATTTAAAATGAA
AGTGATGAGTCTAGCACAAATAAGGATTGTATTTGA


>TTHERM_00684460(protein)
MSEQPLQQVQPQQNLDQNNDDLIDSKIDQNNADLQNQNDFDPIEDENDINESDSNENNSQ
NNLQEEQKSENQVEDNNQKLSKNEMKRQKRAEMWESIKKKKKELKKQEKEKKKLERQQQH
IENSKNQEEVIQQKQQHKEPYKSNQQLRDEYSNRAKNGQPIILDMQFLDMLEDKEFKSLV
KQLCYMQSSNKKAEKPCRFIISSVSPKLRQALNANNADKWGIEILDQHYLDLFPKDNLVY
LTGDTDQDLDELDQQCAYIIGGLVDHNRLKNVTLNAATEQGIQVKRFPIQNHLKLEASSI
LACNHVFDIMVQRANGKSWKESLQTGIPIRKVVALIENGVEIPTEHYLKKLEQMKKQQQI
ALEKKKLQEQSQEFIKDSQKASTYNEIKETDLKESDIQNESDESSTNKDCI


>TTHERM_00684460(gene)
ATCAATTTATAAAATTTTAATTAAATTGAAACAACTATATATTAATTTTTACATATTTTT
ATCCTTTTTACTCAATAAACATAATTTTAATTGAAAAGCTTAATCAATTTAATGAGCGAG
TAACCTCTGTAGCAAGTTTAGCCATAATAAAATTTAGACTAAAATGTATTTGTTTATAAA
TTAATTTCTTTTAGTCACCTTTTGATTGTATTAAATATTTTAAAAGAATGATGATTTAAT
TGATTCAAAGATAGATTAAAACAATGCCGATTTATAGAATTAAAATGATTTCGATCCTAT
AGAAGATGAAAATGATATAAATGAAAGTGACAGTAATGAAAATAATAGTTAAAACAATTT
ATAAGAAGAGTAAAAATCAGAAAACTAAGTAGAAGACAACAATTAAAAGTTATCAAAAAA
TGAAATGAAAAGATAAAAGCGTGCAGAGATGTGGGAATCAATAAAGAAGAAGAAGAAAGA
GCTAAAAAAGTAAGAAAAAGAAAAGAAGAAATTAGAAAGATAGCAATAACATATTGAAAA
CTCAAAAAATTAAGAAGAAGTAATTTAGTAGAAATAGCAGCATAAAGAACCTTATAAATC
TAATTAATAACTAAGGGATGAGTACTCTAATAGAGCAAAGAATGGTTAGCCTATTATTTT
GGATATGTAATTTTTAGATATGTTAGAAGATAAAGAATTTAAAAGTTTAGTGAAATAATT
ATGTTACATGTAATCATCTAACAAAAAGGCTGAAAAACCTTGTAGATTTATAATATCATC
TGTAAGCCCTAAACTTAGATAAGCCCTCAATGCAAATAATGCAGATAAGTGGGGTATTGA
AATACTAGATCAGCACTATTTAGATTTATTTCCAAAGGATAATTTAGTCTATTTGACTGG
TGATACAGACCAAGATTTAGATGAGTTAGACTAATAGTAAGTACATTTTAAAAAAATGTA
TCTTTAAATTTTTTTAAAAAAAGATGTGCTTATATAATTGGTGGACTTGTAGATCATAAT
AGATTAAAAAATGTAACTTTGAATGCTGCCACGGAATAAGGTTTAATTGAAATTTATTTG
TAAAACATTTTCACTAAAAAAAATACAAATATTAGGAATTCAAGTAAAGAGATTCCCAAT
TTAAAATCATTTAAAACTAGAAGCCTCAAGTATACTTGCATGCAACCACGGTAATAAAAT
TATTTAGTTTAAAAATAATGTTTTGTAGCAACTTGCAAAATACTTTTTGTTTCCTGACAA
ATTAGCCTATCTAATTTCTCATTAAAATTTGGTGTTCATTTTTTTAAACTTTTTAAATTT
TTAAAACTCGTGCTAATTACAGTAAAAACAAAAGTGCTATAAATAATATCAAATAAAAAT
AAATTTATCATATTCGAATTGATTTGAGATTTTTATGGATTGAATGAGATTAGATTTTAT
CAAAAATTTAAATTGCTTATTTGTAATTTATCAAGAATGAGATAACTTTTATCAAATTTA
TAAACATTTTATTTAATTTTTAAAATAGTTTTTGATATTATGGTCCAAAGAGCTAATGGA
AAAAGTTGGAAGGAAAGTTTATAAACTGGAATTCCTATACGTAAAGTAGTTGCCTTGATA
GAAAATGGAGTAGAAATCCCTACAGAGCACTATTTAAAAAAGTTAGAATAAATGAAAAAA
TAGTAATAGATTGCTTTAGAAAAGAAAAAGCTCTAAGAATAATCTTAGGAATTTATTAAA
GATAGCTAAAAAGCTTCAACATATAATGAAATTAAAGAAACTGATTTAAAAGAATCTGAT
ATTTAAAATGAAAGTGATGAGTCTAGCACAAATAAGGATTGTATTTGA