Identifiers and Description

Gene Model Identifier

TTHERM_01507100

Standard Name

TRM6 (tRNA methyltransferase 6)

Aliases

PreTt17037 | 431.m00007

Description

tRNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01746 ) tRNA (guanine-N1)-methyltransferase
  • ( TIGR00100 ) hydrogenase nickel insertion protein HypA

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01507100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20063.12.998603118130212e-178tRNA m(1)G methyltransferase (
394 aa)
SGDYOL093W1.9991095569230066e-20TRM10 tRNA methyltransferase,
methylates the N-1 position of
guanosine in tRNAs
WormBaseWBGene000091310.0000000000000299873730555305status:Confirmed UniProt:A5J
YS8 protein_id:CAN86601.1
OxytrichaContig4343.0.g460.0000000000000700196834671948tRNA synthetases class I (W an
d Y)
DictyBaseDDB_G02740730.00000000000020009182674645818DDB_G0274073 on chromosome: 2
position 3737258 to 3738394

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01507100(coding)
ATGAACTAAGAAACATAATAGAAAATGGAAGTATCAGATAAAGTAGAAAAGGAGAATTCT
ATAGGAGATGAACATGAAGATGAAAACCAAGATTTAGTAGAAGATTTATTATTTGGAGAT
ATAGAATTTGAGAGTAAAGAATTCAAAATAGAGAGATTATCTCATAGCTAAAAAAAATTA
TAATAATATCATTAGCATTTGCAAAAACATACTGATAAGGAATTTTTAAAGGATAAATGG
AATCAAAGAAAGAAAAGAGTTAATAAGCGTTTAGATGGATTGTCAAATGATGAAAAATTC
TAAGAAAGATGCAAACGTAAAGAAGAAATCGAATAAGAAAGATTAAATATGATCAAAGGC
TACGAAAGTGGTATTCCATTGATTATTGATAACTCTTTTGAGTAGTATATGACATTTAGA
GAAATACGTTCTTTGGCCATACAAATTTCATAAACAGTTTTTGCTTAGAGAAAAAATAAA
AATCCCTTTTAGGTGAATGTCTGCAACGCTTCTTAATAATTGAAGGATTGCATGAACACA
CAAATTTTCAAAAAGTTGCCTTTTAATGTATATGAACAAGATATTTTAGAAATTGAAAGG
TTTAAAGGAAAAGAAGCAAATATGATTTATTTATCACCTGATAGCGAAAATGAGCTAGAA
ACTGTCGATCCTAGTGGGAATACAATTTATATAGTAGGAGGTTTAATAGATAGGACAGTT
AAGAAATGGGCTAGTTATGATAGAGCAAATTCTATGAATATCAAATCAGCTAAATTGCCT
ATTAATTAATACTTAAGTGATCTTACTAGGAGAGCCTTAAATATAGACACTGTGACAGTC
ATGATGGGATTAGCAATACATCTTAATTTTGATTGGAAGACTACCACTTTGACTGTTTTA
GGAAATAGAAAAATTAATGAAGACCTTAAAGAAGAACAAAAGCAAATCTATTGA


>TTHERM_01507100(protein)
MNQETQQKMEVSDKVEKENSIGDEHEDENQDLVEDLLFGDIEFESKEFKIERLSHSQKKL
QQYHQHLQKHTDKEFLKDKWNQRKKRVNKRLDGLSNDEKFQERCKRKEEIEQERLNMIKG
YESGIPLIIDNSFEQYMTFREIRSLAIQISQTVFAQRKNKNPFQVNVCNASQQLKDCMNT
QIFKKLPFNVYEQDILEIERFKGKEANMIYLSPDSENELETVDPSGNTIYIVGGLIDRTV
KKWASYDRANSMNIKSAKLPINQYLSDLTRRALNIDTVTVMMGLAIHLNFDWKTTTLTVL
GNRKINEDLKEEQKQIY


>TTHERM_01507100(gene)
ATGAACTAAGAAACATAATAGAAAATGGAAGTATCAGATAAAGTAGAAAAGGAGAATTCT
ATAGGAGATGAACATGAAGATGAAAACCAAGATTTAGTAGAAGATTTATTATTTGGAGAT
ATAGAATTTGAGAGTAAAGAATTCAAAATAGAGAGATTATCTCATAGCTAAAAAAAATTA
TAATAATATCATTAGCATTTGCAAAAACATACTGATAAGGAATTTTTAAAGGATAAATGG
AATCAAAGAAAGAAAAGAGTTAATAAGCGTTTAGATGGATTGTCAAATGATGAAAAATTC
TAAGAAAGATGCAAACGTAAAGAAGAAATCGAATAAGAAAGATTAAATATGATCAAAGGC
TACGAAAGTGGTATTCCATTGATTATTGATAACTCTTTTGAGTAGTATATGACATTTAGA
GAAATACGTTCTTTGGCCATACAAATTTCATAAACAGTTTTTGCTTAGAGAAAAAATAAA
AATCCCTTTTAGGTGAATGTCTGCAACGCTTCTTAATAATTGAAGGATTGCATGAACACA
CAAATTTTCAAAAAGTTGCCTTTTAATGTATATGAACAAGATATTTTAGAAATTGAAAGG
TTTAAAGGAAAAGAAGCAAATATGATTTATTTATCACCTGATAGCGAAAATGAGCTAGAA
ACTGTCGATCCTAGTGGGAATACAATTTATATAGTAGGAGGTTTAATAGATAGGACAGTT
AAGAAATGGGCTAGTTATGATAGAGCAAATTCTATGAATATCAAATCAGCTAAATTGCCT
ATTAATTAATACTTAAGTGATCTTACTAGGAGAGCCTTAAATATAGACACTGTGACAGTC
ATGATGGGATTAGCAATACATCTTAATTTTGATTGGAAGACTACCACTTTGACTGTTTTA
GGAAATAGAAAAATTAATGAAGACCTTAAAGAAGAACAAAAGCAAGTAGTTTTAGAAGGA
GTTGAAAAGCTTGGCAGTTCTAAACTTGATAAAAGTTCACATCTCATTGATATATAAAGA
TCTATTGA