Identifiers and Description

Gene Model Identifier

TTHERM_01166310

Standard Name

TRM4 (tRNA methyltransferase 4)

Aliases

PreTt28822 | 261.m00030

Description

tRNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04648 ) Yeast mating factor alpha hormone
  • ( TIGR01210 ) conserved hypothetical protein TIGR01210
  • ( PF02005 ) N2,N2-dimethylguanosine tRNA methyltransferase
  • ( TIGR00308 ) N2,N2-dimethylguanosine tRNA methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_01166310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_1070
Tetrahymena borealisEI9_10191.14.997543945741262e-17hypothetical protein (659 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01166310(coding)
ATGAATATAACTCTTCTTGCGTCTAATTAATACTTCAAAGATTTAGAAATCACAAGAAAA
TGTTAGAATTCTAAAGGAAGGAGCCAAAATTTTGTAAAAGGCAAATCAAGATCAGTGATA
AAGAGATTGAGATACATAAAATAAATAGATCCATCATATATCAAAGATATAACAGTAATT
GAAAAAAATATTAACTTCCCTAAATACCTCAAGTTATTAGCTCATTACAATGATATTGAA
ATATATAAATTTAAATTTAAAAGGTATTTAGTTCAATGGGGATCTTAGTTAGTAACGAAA
ACAAGGAATAAATTAAATTCTGATATCATTAATGCTCTTGAATTTTTAAAGAAAAACCTT
TAGTATAACTCAATAGCTATAGCTAAGGAAGATATCTAATCTTATTTGTATATAGAATTT
TTATTTATTAAAAAAATTAGATAGTAATTTTTATGTCTATACATTGTAATAATAATTTTT
TATGTCTCCACATTATATTAATAATTTTTTATGAAAAATTTTTTTCGCTTATCCAATTTA
TGTTTTATTAAAAATATCCTTATTTATGTTTATATAACTAATAGATTACAGTTAATATAT
TTACTAAGTAACTTTTTATTTAATGGTGTCTTCTAATATCTGAAACAATAGCACCAAAAA
TTTTCTATATTTTTTTTTATTTTCATAAAAAATTATCATAAATAATAATTTATAATTTGT
ATTAAATAATTTTAGAAGAAAATTTAAGTTTAGATAATATGA


>TTHERM_01166310(protein)
MNITLLASNQYFKDLEITRKCQNSKGRSQNFVKGKSRSVIKRLRYIKQIDPSYIKDITVI
EKNINFPKYLKLLAHYNDIEIYKFKFKRYLVQWGSQLVTKTRNKLNSDIINALEFLKKNL
QYNSIAIAKEDIQSYLYIEFLFIKKIRQQFLCLYIVIIIFYVSTLYQQFFMKNFFRLSNL
CFIKNILIYVYITNRLQLIYLLSNFLFNGVFQYLKQQHQKFSIFFFIFIKNYHKQQFIIC
IKQFQKKIQVQII


>TTHERM_01166310(gene)
ATGAATATAACTCTTCTTGCGTCTAATTAATACTTCAAAGATTTAGAAATCACAAGAAAG
TAAAATTCTAATTAATCAATTTATATTCAATCTTCATAATGTGTTATAAAGATGTTAGAA
TTCTAAAGGAAGGAGCCAAAATTTTGTAAAAGGCAAATCAAGATCAGTGATAAAGAGATT
GAGATACATAAAATAAATAGATCCATCATATATCAAAGATATAACAGTAATTGAAAAAAA
TATTAACTTCCCTAAATACCTCAAGTTATTAGCTCATTACAATGATATTGAAATATATAA
ATTTAAATTTAAAAGTAAAATAAATTGATTTTATTATTAGCTAAACAATAAAATTTTAAT
ATTTTTGATAGTAGACATTGAATCTAAATGTTCTAATTTAATAGTATCTGTAAATTATTT
AAGTTGTTATCAAATTAATTCATAAAATTATCTTAAAAATAAATGCATATTAATTTAGAA
AAGCTCTATTTAAATCTTCATTCATTTATTTAATAAATATTTTCATTTAAGGACTTTATT
TATGTATTTTACTAGATGTAAAAAACCAATAAATATAAATTAATTATGTTTATTATTTTC
TGCATAATATTTATACTAACTTAAAAATTTATTTGACTTTAAAAAAAATATTTTTATTTT
TAAGCAACAAGAGCATATATAGTCAGAAATGTAATAAAAATAAATATACAAATATAAAAA
ATTATTTCAATTCTTTTTTTAAAATAGGGTATTTAGTTCAATGGGGATCTTAGTTAGTAA
CGAAAACAAGGAATAAATTAAATTCTGATATCATTAATGCTCTTGAATTTTTAAAGAAAA
ACCTTTAGTATAACTCAATAGCTATAGCTAAGGAAGATATCTAATCTTATTTGTATATAG
AATTTTTATTTATTAAAAAAATTAGATAGTAATTTTTATGTCTATACATTGTAATAATAA
TTTTTTATGTCTCCACATTATATTAATAATTTTTTATGAAAAATTTTTTTCGCTTATCCA
ATTTATGTTTTATTAAAAATATCCTTATTTATGTTTATATAACTAATAGATTACAGTTAA
TATATTTACTAAGTAACTTTTTATTTAATGGTGTCTTCTAATATCTGAAACAATAGCACC
AAAAATTTTCTATATTTTTTTTTATTTTCATAAAAAATTATCATAAATAATAATTTATAA
TTTGTATTAAATAATTTTAGAAGAAAATTTAAGTTTAGATAATATGA