Identifiers and Description

Gene Model Identifier

TTHERM_00218280

Standard Name

TRM3 (TRNA Methyltransferase 3)

Aliases

PreTt22255 | 18.m00281 | 3701.m00041

Description

RNA methyltransferase; TrmH family protein; assists with high fidelity protein synthesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02524 ) KID repeat
  • ( PF01461 ) 7TM chemoreceptor
  • ( TIGR01612 ) rhoptry protein
  • ( PF00335 ) Tetraspanin family
  • ( TIGR01257 ) rim ABC transporter
  • ( PF03006 ) Haemolysin-III related
  • ( PF00119 ) ATP synthase, A subunit
  • ( TIGR00669 ) aspartate--ammonia ligase
  • ( TIGR01191 ) heme exporter protein CcmC
  • ( PF01578 ) cytochrome C assembly protein
  • ( PF00588 ) RNA methyltransferase, TrmH family
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR01906 ) integral membrane protein TIGR01906
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF02687 ) efflux ABC transporter, permease protein
  • ( TIGR00185 ) RNA methyltransferase, TrmH family, group
  • ( TIGR00186 ) RNA methyltransferase, TrmH family, group
  • ( PF00499 ) NADH-ubiquinone/plastoquinone oxidoreductase chain 6
  • ( PF02532 ) Photosystem II reaction center I

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00218280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06599.19.997093137033517e-262hypothetical protein (2559 aa)
OxytrichaContig12667.0.g308.997777707990486e-82SpoU rRNA Methylase family
DictyBaseDDB_G02854999.999142814001536e-47DDB_G0285499 on chromosome: 4
position 3314745 to 3319892
WormBaseWBGene000204985.999781043483669e-32status:Partially_confirmed U
niProt:Q22484 protein_id:CCD
65279.1
SGDYDL112W1.9996410647472548e-29TRM3 2-O-ribose methyltransfer
ase, catalyzes the ribose meth
ylation of the guanosine nucle
otide at position 18 of tRNAs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000346

Sequences

>TTHERM_00218280(coding)
ATGAGCATAGACGTTGTTTTACAATCATTAATTCCAAAAAAGGCTACAGATGATTAAACA
ATTTACACTTTGCTGAAGTAGTATGCTGTTTTATAAGTTAGCTTAAAGCAAAATGAGTAA
TTTTCAGCAGAAATTAGCTAGGAGTTAAATAGTGTATTTTAGAAAAACATAAATGACGAA
TCTATAAAAAATAATGCGCAATTTCATAGAAAATATTTGTTTTGCCTCCTTTACTTGTAT
CAGCAACTCAAATAAAATAAAATTATGGTCTAAATAGATGTTTTACAAGGACTTTTTGAA
TTCTCTCTAAGTCTCAGTTTAACATCTACATAAATTAACTACTATTTTGTTCTAAAAACA
TTCAACAAAATTTTAGTGAAGTAAGGAGGAGAACAAATCAATGTGATGATAAATGAATTT
TTAAATGCAGAAATTATTTTAGAAAGCTCTGTTTTGCAGTTCTACAAAACTCTTAAAGAA
AAAGTAGAACATGCAGATATAGAAAGTCACCATACTCAACATCTTAAAAAGCAAGAAATA
TTGATAGATTTTTATATAGAGTATGTCTAACTCAACATTAAAAAGGGGTAATTCTCCTAA
ATTAGTGAGTCCGTCCAAGGAGTTACAAAAGATATATTTAAGGTCTACATTTGGAATGAA
GATACAACTTCTATTTTCTAAAAAGTTTGCAGTAGTGAAGCCAATGGTTTTGATTTTTCA
AAATACAATGTTAATTCTCTTTATAATGCCAATTATTTTAATAAAATGAGAGAAATATTG
TTCAAATACTTTAGGACACTATTTTAGTCATAAAAATCTATTCAAGATAACATCTCTAGT
GAATTTAGAAAGAGGTATTTATAGTAGAGAAATAACCTTAGTAGCTAGCCTGATAAATAG
CATAACTTACTTTGTTTTGAAGTTATTAAATTTGTAGAGCTCTTGTACTTCAATAGAAAG
TATGACTTAAATGATGAAATTGTTAAAAGCGAATTTTATTGGAGTGATTTGAAAAATACT
CTCGAATTATATGAAAATTTCGAAGCCTGTAAACAAGGTGTTAATGCTTTAAATGGTATT
CTTGAATCAGTTTAAAATAGATTTAATGAAAAGGATATTAAAAATGATAAAAATCTTTTG
GAATATAGTAAAATTTACACAAAAAAGTATAAAACTTTTGTAGATCTTTACATAACACTT
GACAGTTTTGCAGTTCACTTGATTAAAAGCTTGTGGCCTCAATTAGCTAATTTCTTTTAA
AAAGATCCTGTAGGGATCAATAAAATTGTAGAAAAAATCCCAATTTTACATCATTTGAAC
TCTGAATGGCCAGTATATATCTTATTCAAAAAATCAATTTATCACAACAATTAAAGTATT
GTTAAATGCTGTGTAAAGTATTTCTTGAAAATGGAAGAAATAGATATTGATGATTTATAA
GACTTGATATATGACTATGCAGTGCCTATTTTAAATAACTGTTTATTTTACAATGATGCT
ACTCTAGATGCTGATAGTAAATTCTATAACGTTGTTTAAACTTTCTTTTTGAATGCCTAT
CAAAAAATACTCAAAAATTTAAAAGAAAAACTAGAATAGTCCAATTAAGCTCAAGAATAT
GAAGAATGTAGTAAAAAATTACTCAACCATCACTTAAAGAGATTGATCTAATCTGTTTGC
AAGCATATTGTTCACCCTTAGGCAGTTTGCGCCTTTTTATTAGTTTTTTCTAACTTGAAT
GAACAAAGCACCTCTATAAGTAGTGAAGAGATAAAAATGATATTAGACTTTACTCAAAGA
GTTTATGCAAGAGCAAACGTTAGAAAAAGAACTATTTTTGCTAAAGGGTTAATTTCATTA
ATTGTCAATCATTTAGATATTTAAAACATTGAAAATGAGTAAATTTATGATTTGATACTT
GGATTCCCTTAACAAACTTTCGAATGGATGAGCATCAAGCAATTTAATGGGCCTTAGCAT
TTAATTGAACTTGATTTAGTTAAAATAAATGAAGAAATAAACTCTTCATTTTAATACAAG
AGCAAATTATTGTATTTCTTGATAAAAAATGCTGAAAAATTAAACATCTCTTAGACTTTA
ATTGACTTAAGAAACAATATATCTTAGATTAAATTGTAAAATAATGAAGATTAACACTCG
TATTAAGATATGAATTAATAATATTTAAAATTCTTAAGTTTTACCAATATTTTACTAGAA
ATACCCTCTTATTCTCATGCAATTAAACATCTAATTGATAATTCTAAAGAAATTAAAAAA
GAATTAGAGTTCCTTTATTAGTTCTCTATTGATGGCAAATTAGCAGAATTTACTTCTTCT
TGGCTTTTTAATGACAAAATATCTGATATTTATACTAATTCTTATCGCCCTTACTAAGAA
AGTACTTAATATATTCTGCAATTAAAAGAATTGATAAAGCTATTTAAGGATACAAAGGAA
ATGAAAAAAATACATGAATAATTAGACTCTGTTAGTGCTGATCTTCTCAGTTATTTAATG
CTTAGAATATCAGAAAAGGATATTGATTCTAAATAATACTCTGATTTTTCTTACTACTAA
AATGAAATTTTAGATCTGTTCTTCAATTTGTACTATTATGCTATCTCTCCTCAATTGCTC
AGACCTACTCACAAATTATCTACTTCTCTATCTAAAGCTATTAAAAATATGTTTGAATAA
TTGATTTAACTTTTAAATAGATAAACTTCATAGTCACATTCAAACGAATCCATTCTATCA
CCTGGTGAAGAATAACTAGTGTGCCTTTACTTTGAAATTTTATCTTGTATCTGTAAGTCA
AATTTAGATATAATTTAATAATCACAAAAAAGTGCTAACAGTTCTATTTTTATTGATGAT
TTAATATTTGACAAGGGTTTGGAATTGGTTTAAATCCTATCCTTATATGACTCGCCTAGT
GATTAAAATTATCCAGTTATCAAATAGTTGGCTTCAAAGCGTGGGTTCTTATCTAAATCT
CATGCACTTCTTTGCAATTTAATGAGCTTGCTAAGCTTTAGCAACGAAATTTATAACAAC
CCTAATTTCACCAATATTATTGATAAAGTAGTTGCAGATGCATATTATCTTGCAGATGTC
TTTGATTTTAATAAATTAGATGAGCTCTTTATCATGTTGAAATATGTTTATAATCCTTAC
CTTGTAAGTCACCTCAATGATGAAAACTAAGAATAGCTTATTAAAGACTTTAAAAATCTT
TTTGAGTTATGTTTCAACCAAAATATTTTAACAACTTAATTAAATTACATAACTTATAAA
GAAGTTCACTATATGTACGAATGGGCTTTGGACCAAACACTATTTTACAATCCTTACATA
ATAAAATCTGACATTATTTAACATTTTATTAAGGTAACCTTGAAGGCAGGTTAAAATAAT
TGGTTACTATAGAGAAAAGTTGTGGATAAAATAGCTTCAATATTTTATTCTGACCCTTCT
TTACTTGTTTCTTTTGAGAAAACTATTTATAGATTCATCAAAATAAAAGAATATAGAGGA
TTTGATAATGGAATGGAGTTCTATAAAGATGAGTTAGAAATTCCTTTAGCAAATGAACTC
AAAACCAAATTTTCTAATAACATAGAATATTATGGAGCTTTCCCAAGATTTATGATACTA
AAACTATTAGAGAATATTGTTATCTGGATTAATAATTGTGTGAATAATCCTAGTGATTTA
TTAGATGAGGTTACTAAAGCTAAATTTAAAACTTTAATTGATTTTTATATAAAATATACA
TAAAATTTGTTAGAAAGAAATTACTAAAAGAAGTACTAAAAGTCAAGAAACTCACTTCTT
CCAAATACCAACCATTATAACTCAAAAATCCGTATGTGGCAGTGTCTCTGTGTTATTAAA
GATTTCTTTACTGAAAAAGTTATGAACTTCATTAAAAATACCTTTGATTAATCAGAGTAT
AATGTTGATAGACTTATATCTGACATCAAAGAAAAAATTTGGGGAATCTTAGATTTTAAC
AATTAAGTCAACATTAGACAATATATTGAAGTATTTACTCTTCACTTATACAATGAATTC
CCAGTTTATTTTGAATAGAGCATCATAGATGGAATCAAGGAAAAAAATAACAGATCTCAA
TACTCTATTCCCTTAGTTTTTATGGCTGGTTATCAATTATGCAGAAAACCAAATAATCTT
AAAGCCAAAGAAGTTTTATCTCATTTAATTCCATATACTGGATCACATGTTGCATATCTT
AGATCTATTGCATAGTACTTTGTTTCCAAATTCACTGAAGCTAATGAAGAACAAATTAAG
GATGATATTTTATTGAAGAATCTGAATTCATTTTTTACAGAAAACAAAGAATCCATAAAA
ATGAGAAAAACATTTGATAAAATTGTAGAAAAATTCCAAAAGGTTATTGAAAACTTTAAT
ACAGAGCAACTTTTGAGTATTGACATGGATGGAAATGGTGAGGTGGTTCACGAAAATGTG
ATTGAAGAAATAAAAAATGTTTGTATGAACTTGATATATTAATTAAAAGAACATGAAGAT
GCTCCTCCCAAAAAAGACGATTTATGGAGATTAAAAACTTAAGAATTCATTCAAGATATT
CCAATTCCTGATTTAAGTGAGGTTACAAACTTCTAGAGAAAAATTGATGTGGTTTAGAAT
GAACTAGATTAAATTGAAGCTGAAAAGAAAAAAAGGAGAAAAGAAAAAGACATCATAGTT
GTAGCATCATTGTTAGAAAAGATACCTAATTTCGGACACTTAACAAGAACTAGTGAAATT
TTCGGAGTCTCTTCATTGGTCATTCCTAATAAAGCAATTTTGGAAGAAGAAGGTTTCAAG
GCTATATCAGTTACAGCAGAGAAATGGCTTCCTATTTAAGAAGTAAAGGAAAAAGATCTT
ATGGCTTTCCTGATTCTTAAGAAAAAGCTTGGCTACAAAATTGTTGGATTAGAACAAACA
AGCAAAAGTAAGATGATACAACATTAAGAATTCCCTGATAAATGTATACTTCTTTTAGGA
AGAGAAAAAACAGGTATCCCTCTTGAGTATATTGAAATATTAGATGAATGTGTAGAGATT
CCTTAATTCGGATAAGTAAGATCTCTTAACGTTCATGTTAGTGCAGTTATTTGCATTTGG
GAGTTTGTCAAGTAAAAATTTATCAAAGAATGA


>TTHERM_00218280(protein)
MSIDVVLQSLIPKKATDDQTIYTLLKQYAVLQVSLKQNEQFSAEISQELNSVFQKNINDE
SIKNNAQFHRKYLFCLLYLYQQLKQNKIMVQIDVLQGLFEFSLSLSLTSTQINYYFVLKT
FNKILVKQGGEQINVMINEFLNAEIILESSVLQFYKTLKEKVEHADIESHHTQHLKKQEI
LIDFYIEYVQLNIKKGQFSQISESVQGVTKDIFKVYIWNEDTTSIFQKVCSSEANGFDFS
KYNVNSLYNANYFNKMREILFKYFRTLFQSQKSIQDNISSEFRKRYLQQRNNLSSQPDKQ
HNLLCFEVIKFVELLYFNRKYDLNDEIVKSEFYWSDLKNTLELYENFEACKQGVNALNGI
LESVQNRFNEKDIKNDKNLLEYSKIYTKKYKTFVDLYITLDSFAVHLIKSLWPQLANFFQ
KDPVGINKIVEKIPILHHLNSEWPVYILFKKSIYHNNQSIVKCCVKYFLKMEEIDIDDLQ
DLIYDYAVPILNNCLFYNDATLDADSKFYNVVQTFFLNAYQKILKNLKEKLEQSNQAQEY
EECSKKLLNHHLKRLIQSVCKHIVHPQAVCAFLLVFSNLNEQSTSISSEEIKMILDFTQR
VYARANVRKRTIFAKGLISLIVNHLDIQNIENEQIYDLILGFPQQTFEWMSIKQFNGPQH
LIELDLVKINEEINSSFQYKSKLLYFLIKNAEKLNISQTLIDLRNNISQIKLQNNEDQHS
YQDMNQQYLKFLSFTNILLEIPSYSHAIKHLIDNSKEIKKELEFLYQFSIDGKLAEFTSS
WLFNDKISDIYTNSYRPYQESTQYILQLKELIKLFKDTKEMKKIHEQLDSVSADLLSYLM
LRISEKDIDSKQYSDFSYYQNEILDLFFNLYYYAISPQLLRPTHKLSTSLSKAIKNMFEQ
LIQLLNRQTSQSHSNESILSPGEEQLVCLYFEILSCICKSNLDIIQQSQKSANSSIFIDD
LIFDKGLELVQILSLYDSPSDQNYPVIKQLASKRGFLSKSHALLCNLMSLLSFSNEIYNN
PNFTNIIDKVVADAYYLADVFDFNKLDELFIMLKYVYNPYLVSHLNDENQEQLIKDFKNL
FELCFNQNILTTQLNYITYKEVHYMYEWALDQTLFYNPYIIKSDIIQHFIKVTLKAGQNN
WLLQRKVVDKIASIFYSDPSLLVSFEKTIYRFIKIKEYRGFDNGMEFYKDELEIPLANEL
KTKFSNNIEYYGAFPRFMILKLLENIVIWINNCVNNPSDLLDEVTKAKFKTLIDFYIKYT
QNLLERNYQKKYQKSRNSLLPNTNHYNSKIRMWQCLCVIKDFFTEKVMNFIKNTFDQSEY
NVDRLISDIKEKIWGILDFNNQVNIRQYIEVFTLHLYNEFPVYFEQSIIDGIKEKNNRSQ
YSIPLVFMAGYQLCRKPNNLKAKEVLSHLIPYTGSHVAYLRSIAQYFVSKFTEANEEQIK
DDILLKNLNSFFTENKESIKMRKTFDKIVEKFQKVIENFNTEQLLSIDMDGNGEVVHENV
IEEIKNVCMNLIYQLKEHEDAPPKKDDLWRLKTQEFIQDIPIPDLSEVTNFQRKIDVVQN
ELDQIEAEKKKRRKEKDIIVVASLLEKIPNFGHLTRTSEIFGVSSLVIPNKAILEEEGFK
AISVTAEKWLPIQEVKEKDLMAFLILKKKLGYKIVGLEQTSKSKMIQHQEFPDKCILLLG
REKTGIPLEYIEILDECVEIPQFGQVRSLNVHVSAVICIWEFVKQKFIKE


>TTHERM_00218280(gene)
ATGAGCATAGACGTTGTTTTACAATCATTAATTCCAAAAAAGGCTACAGATGATTAAACA
ATTTACACTTTGCTGAAGTAGTATGCTGTTTTATAAGTTAGCTTAAAGCAAAATGAGTAA
TTTTCAGCAGAAATTAGCTAGGAGTTAAATAGTGTATTTTAGAAAAACATAAATGACGAA
TCTATAAAAAATAATGCGCAATTTCATAGAAAATATTTGTTTTGCCTCCTTTACTTGTAT
CAGCAACTCAAATAAAATAAAATTATGGTCTAAATAGATGTTTTACAAGGACTTTTTGAA
TTCTCTCTAAGTCTCAGTTTAACATCTACATAAATTAACTACTATTTTGGTAATAATTAA
ATGAATATTTTATTTTTTTAATAATTAAAATAGCTATGAACAAAAATAATTATTTTTTTT
AATGAAAAGTTCTAAAAACATTCAACAAAATTTTAGTGAAGTAAGGAGGAGAACAAATCA
ATGTGATGATAAATGAATTTTTAAATGCAGAAATTATTTTAGAAAGCTCTGTTTTGCAGT
TCTACAAAACTCTTAAAGAAAAAGTAGAACATGCAGATATAGAAAGTCACCATACTCAAC
ATCTTAAAAAGCAAGAAATATTGATAGATTTTTATATAGAGTATGTCTAACTCAACATTA
AAAAGGGGTAATTCTCCTAAATTAGTGAGTCCGTCCAAGGAGTTACAAAAGATATATTTA
AGGTCTACATTTGGAATGAAGATACAACTTCTATTTTCTAAAAAGTTTGCAGTAGTGAAG
CCAATGGTTTTGATTTTTCAAAATACAATGTTAATTCTCTTTATAATGCCAATTATTTTA
ATAAAATGAGAGAAATATTGTTCAAATACTTTAGGACACTATTTTAGTCATAAAAATCTA
TTCAAGATAACATCTCTAGTGTAAGTTTATTTTCTAAATAATACAATATAATTTTTTTTT
AAAGGAATTTAGAAAGAGGTATTTATAGTAGAGAAATAACCTTAGTAGCTAGCCTGATAA
ATAGCATAACTTACTTTGTTTTGAAGTTATTAAATTTGTAGAGCTCTTGTACTTCAATAG
AAAGTATGACTTAAATGATGAAATTGTTAAAAGCGAATTTTATTGGAGTGATTTGAAAAA
TACTCTCGAATTATATGAAAATTTCGAAGCCTGTAAACAAGGTGTTAATGCTTTAAATGG
TATTCTTGAATCAGTTTAAAATAGATTTAATGAAAAGGATATTAAAAATGATAAAAATCT
TTTGGAATATAGTAAAATTTACACAAAAAAGTATAAAACTTTTGTAGATCTTTACATAAC
ACTTGACAGTTTTGCAGTTCACTTGATTAAAAGCTTGTGGCCTCAATTAGCTAATTTCTT
TTAAAAAGATCCTGTAGGGATCAATAAAATTGTAGAAAAAATCCCAATTTTACATCATTT
GAACTCTGAATGGCCAGTATATATCTTATTCAAAAAATCAATTTATCACAACAATTAAAG
TATTGTTAAATGCTGTGTAAAGTATTTCTTGAAAATGGAAGAAATAGATATTGATGATTT
ATAAGACTTGATATATGACTATGCAGTGCCTATTTTAAATAACTGTTTATTTTACAATGA
TGCTACTCTAGATGCTGATAGTAAATTCTATAACGTTGTTTAAACTTTCTTTTTGAATGC
CTATCAAAAAATACTCAAAAATTTAAAAGAAAAACTAGAATAGTCCAATTAAGGTATTAT
ATTTGATTGATGATTTTGAATTTTTAATTATTTTTAAAAAACACAAACTTGTATTTTGGT
GAATAGTTTAGTTTATTTCATATCATTTTAATAATAATAAAATAGCTCAAGAATATGAAG
AATGTAGTAAAAAATTACTCAACCATCACTTAAAGAGATTGATCTAATCTGTTTGCAAGC
ATATTGTTCACCCTTAGGCAGTTTGCGCCTTTTTATTAGTTTTTTCTAACTTGAATGAAC
AAAGCACCTCTATAAGTAGTGAAGAGATAAAAATGATATTAGACTTTACTCAAAGAGTTT
ATGCAAGAGCAAACGTTAGAAAAAGAACTATTTTTGCTAAAGGGTTAATTTCATTAATTG
TCAATCATTTAGATATTTAAAACATTGAAAATGAGTAAATTTATGATTTGATACTTGGAT
TCCCTTAACAAACTTTCGAATGGATGAGCATCAAGCAATTTAATGGGCCTTAGCATTTAA
TTGAACTTGATTTAGTTAAAATAAATGAAGAAATAAACTCTTCATTTTAATACAAGAGCA
AATTATTGTATTTCTTGATAAAAAATGCTGAAAAATTAAACATCTCTTAGACTTTAATTG
ACTTAAGAAACAATATATCTTAGATTAAATTGTAAAATAATGAAGATTAACACTCGTATT
AAGATATGAATTAATAATATTTAAAATTCTTAAGTTTTACCAATATTTTACTAGAAATAC
CCTCTTATTCTCATGCAATTAAACATCTAATTGATAATTCTAAAGAAATTAAAAAAGAAT
TAGAGTTCCTTTATTAGTTCTCTATTGATGGCAAATTAGCAGAATTTACTTCTTCTTGGC
TTTTTAATGACAAAATATCTGATATTTATACTAATTCTTATCGCCCTTACTAAGAAAGTA
CTTAATATATTCTGCAATTAAAAGAATTGATAAAGCTATTTAAGGATACAAAGGAAATGA
AAAAAATACATGAATAATTAGACTCTGTTAGTGCTGATCTTCTCAGTTATTTAATGCTTA
GAATATCAGAAAAGGATATTGATTCTAAATAATACTCTGATTTTTCTTACTACTAAAATG
AAATTTTAGATCTGTTCTTCAATTTGTACTATTATGCTATCTCTCCTCAATTGCTCAGAC
CTACTCACAAATTATCTACTTCTCTATCTAAAGCTATTAAAAATATGTTTGAATAATTGA
TTTAACTTTTAAATAGATAAACTTCATAGTCACATTCAAACGAATCCATTCTATCACCTG
GTGAAGAATAACTAGTGTGCCTTTACTTTGAAATTTTATCTTGTATCTGTAAGTCAAATT
TAGATATAATTTAATAATCACAAAAAAGTGCTAACAGTTCTATTTTTATTGATGATTTAA
TATTTGACAAGGGTTTGGAATTGGTTTAAATCCTATCCTTATATGACTCGCCTAGTGATT
AAAATTATCCAGTTATCAAATAGTTGGCTTCAAAGCGTGGGTTCTTATCTAAATCTCATG
CACTTCTTTGCAATTTAATGAGCTTGCTAAGCTTTAGCAACGAAATTTATAACAACCCTA
ATTTCACCAATATTATTGATAAAGTAGTTGCAGATGCATATTATCTTGCAGATGTCTTTG
ATTTTAATAAATTAGATGAGCTCTTTATCATGTTGAAATATGTTTATAATCCTTACCTTG
TAAGTCACCTCAATGATGAAAACTAAGAATAGCTTATTAAAGACTTTAAAAATCTTTTTG
AGTTATGTTTCAACCAAAATATTTTAACAACTTAATTAAATTACATAACTTATAAAGAAG
TTCACTATATGTACGAATGGGCTTTGGACCAAACACTATTTTACAATCCTTACATAATAA
AATCTGACATTATTTAACATTTTATTAAGGTAACCTTGAAGGCAGGTTAAAATAATTGGT
TACTATAGAGAAAAGTTGTGGATAAAATAGCTTCAATATTTTATTCTGACCCTTCTTTAC
TTGTTTCTTTTGAGAAAACTATTTATAGATTCATCAAAATAAAAGTAATGAATTGAAATT
TGAATAGAAAATCTTATTTTAAATAATTTTTTTCTTAATTAGGAATATAGAGGATTTGAT
AATGGAATGGAGTTCTATAAAGATGAGTTAGAAATTCCTTTAGCAAATGAACTCAAAACC
AAATTTTCTAATAACATAGAATATTATGGAGCTTTCCCAAGATTTATGATACTAAAACTA
TTAGAGAATATTGTTATCTGGATTAATAATTGTGTGAATAATCCTAGTGATTTATTAGAT
GAGGTTACTAAAGCTAAATTTAAAACTTTAATTGATTTTTATATAAAATATACATAAAAT
TTGTTAGAAAGAAATTACTAAAAGAAGTACTAAAAGTCAAGAAACTCACTTCTTCCAAAT
ACCAACCATTATAACTCAAAAATCCGTATGTGGCAGTGTCTCTGTGTTATTAAAGATTTC
TTTACTGAAAAAGTTATGAACTTCATTAAAAATACCTTTGATTAATCAGAGTATAATGTT
GATAGACTTATATCTGACATCAAAGAAAAAATTTGGGGAATCTTAGATTTTAACAATTAA
GTCAACATTAGACAATATATTGAAGTATTTACTCTTCACTTATACAATGAATTCCCAGTT
TATTTTGAATAGAGCATCATAGATGGAATCAAGGAAAAAAATAACAGATCTCAATACTCT
ATTCCCTTAGTTTTTGTAAATAGTTTTTTTTTTATTTTTTAATAATTTTATCTTATTTAT
ATTAGATGGCTGGTTATCAATTATGCAGAAAACCAAATAATCTTAAAGCCAAAGAAGTTT
TATCTCATTTAATTCCATATACTGGATCACATGTTGCATATCTTAGATCTATTGCATAGT
ACTTTGTTTCCAAATTCACTGAAGCTAGTAAATAATTAATATTTAAATCAATAATTAATT
TAACTTAAACTTATCTCAAATAAGATGAAGAACAAATTAAGGATGATATTTTATTGAAGA
ATCTGAATTCATTTTTTACAGAAAACAAAGAATCCATAAAAATGAGAAAAACATTTGATA
AAATTGTAGAAAAATTCCAAAAGGTTATTGAAAACTTTAATACAGAGCAACTTTTGAGTA
TTGACATGGATGGAAATGGTGAGGTGGTTCACGAAAATGTGATTGAAGAAATAAAAAATG
TTTGTATGAACTTGATATATTAATTAAAAGAACATGAAGATGCTCCTCCCAAAAAAGACG
ATTTATGGAGATTGTAAAATAAATTCAACTGATATATTGTTAAATATTTTAATATTATCA
ATTAGAAAAACTTAAGAATTCATTCAAGATATTCCAATTCCTGATTTAAGTGAGGTTACA
AACTTCTAGAGAAAAATTGATGTGGTTTAGAATGAACTAGATTAAATTGAAGTATTTATT
TATTTATTCTTAATATTTCTAAAATATTAAACAAAAAATGTAAAATAAATAGGCTGAAAA
GAAAAAAAGGAGAAAAGAAAAAGACATCATAGTTGTAGCATCATTGTTAGAAAAGATACC
TAATTTCGGACACTTAACAAGAACTAGTGAAATTTTCGGAGTCTCTTCATTGGTCATTCC
TAATAAAGCAATTTTGGAAGAAGAAGGTTTCAAGGCTATATCAGTTACAGCAGAGAAATG
GCTTCCTATTTAAGAAGTAAAGGAAAAAGATCTTATGGCTTTCCTGATTCTTAAGAAAAA
GCTTGGCTACAAAGTAAATTTTAAGCATAAAAATAAACCTAAAATGATATTTAAAAATTA
AGATTGTTGGATTAGAACAAACAAGCAAAAGTAAGATGATACAACATTAAGAATTCCCTG
ATAAATGTATACTTCTTTTAGGAAGAGAAAAAACAGGTATCCCTCTTGAGTATATTGAAG
TAAATATTGTTCGTTCAATTCAATTATTCTAAAATAAATAAATTTAAAATAACTCTTTAA
ATATTTTTAATTAATTAGATATTAGATGAATGTGTAGAGATTCCTTAATTCGGATAAGTA
AGATCTCTTAACGTTCATGTTAGTGCAGTTATTTGCATTTGGGAGTTTGTCAAGTAAAAA
TTTATCAAAGAATGA