Identifiers and Description

Gene Model Identifier

TTHERM_00218280

Standard Name

TRM3 (tRNA methyltransferase 3)

Aliases

PreTt22255 | 18.m00281 | 3701.m00041

Description

RNA methyltransferase, TrmH family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02524 ) KID repeat
  • ( PF01461 ) 7TM chemoreceptor
  • ( TIGR01612 ) rhoptry protein
  • ( PF00335 ) Tetraspanin family
  • ( TIGR01257 ) rim ABC transporter
  • ( PF03006 ) Haemolysin-III related
  • ( PF00119 ) ATP synthase, A subunit
  • ( TIGR00669 ) aspartate--ammonia ligase
  • ( TIGR01191 ) heme exporter protein CcmC
  • ( PF01578 ) cytochrome C assembly protein
  • ( PF00588 ) RNA methyltransferase, TrmH family
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR01906 ) integral membrane protein TIGR01906
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF02687 ) efflux ABC transporter, permease protein
  • ( TIGR00185 ) RNA methyltransferase, TrmH family, group
  • ( TIGR00186 ) RNA methyltransferase, TrmH family, group
  • ( PF00499 ) NADH-ubiquinone/plastoquinone oxidoreductase chain 6
  • ( PF02532 ) Photosystem II reaction center I

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00218280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06599.19.997093137033517e-262hypothetical protein (2559 aa)
OxytrichaContig12667.0.g308.997777707990486e-82SpoU rRNA Methylase family
DictyBaseDDB_G02854999.999142814001536e-47DDB_G0285499 on chromosome: 4
position 3314745 to 3319892
WormBaseWBGene000204985.999781043483669e-32status:Partially_confirmed U
niProt:Q22484 protein_id:CCD
65279.1
SGDYDL112W1.9996410647472548e-29TRM3 2-O-ribose methyltransfer
ase, catalyzes the ribose meth
ylation of the guanosine nucle
otide at position 18 of tRNAs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00218280(coding)
ATGAGCATAGACGTTGTTTTACAATCATTAATTCCAAAAAAGGCTACAGATGATTAAACA
ATTTACACTTTGCTGAAGTAGTATGCTGTTTTATAAGTTAGCTTAAAGCAAAATGAGTAA
TTTTCAGCAGAAATTAGCTAGGAGTTAAATAGTGTATTTTAGAAAAACATAAATGACGAA
TCTATAAAAAATAATGCGCAATTTCATAGAAAATATTTGTTTTGCCTCCTTTACTTGTAT
CAGCAACTCAAATAAAATAAAATTATGGTCTAAATAGATGTTTTACAAGGACTTTTTGAA
TTCTCTCTAAGTCTCAGTTTAACATCTACATAAATTAACTACTATTTTGTTCTAAAAACA
TTCAACAAAATTTTAGTGAAGTAAGGAGGAGAACAAATCAATGTGATGATAAATGAATTT
TTAAATGCAGAAATTATTTTAGAAAGCTCTGTTTTGCAGTTCTACAAAACTCTTAAAGAA
AAAGTAGAACATGCAGATATAGAAAGTCACCATACTCAACATCTTAAAAAGCAAGAAATA
TTGATAGATTTTTATATAGAGTATGTCTAACTCAACATTAAAAAGGGGTAATTCTCCTAA
ATTAGTGAGTCCGTCCAAGGAGTTACAAAAGATATATTTAAGGTCTACATTTGGAATGAA
GATACAACTTCTATTTTCTAAAAAGTTTGCAGTAGTGAAGCCAATGGTTTTGATTTTTCA
AAATACAATGTTAATTCTCTTTATAATGCCAATTATTTTAATAAAATGAGAGAAATATTG
TTCAAATACTTTAGGACACTATTTTAGTCATAAAAATCTATTCAAGATAACATCTCTAGT
GAATTTAGAAAGAGGTATTTATAGTAGAGAAATAACCTTAGTAGCTAGCCTGATAAATAG
CATAACTTACTTTGTTTTGAAGTTATTAAATTTGTAGAGCTCTTGTACTTCAATAGAAAG
TATGACTTAAATGATGAAATTGTTAAAAGCGAATTTTATTGGAGTGATTTGAAAAATACT
CTCGAATTATATGAAAATTTCGAAGCCTGTAAACAAGGTGTTAATGCTTTAAATGGTATT
CTTGAATCAGTTTAAAATAGATTTAATGAAAAGGATATTAAAAATGATAAAAATCTTTTG
GAATATAGTAAAATTTACACAAAAAAGTATAAAACTTTTGTAGATCTTTACATAACACTT
GACAGTTTTGCAGTTCACTTGATTAAAAGCTTGTGGCCTCAATTAGCTAATTTCTTTTAA
AAAGATCCTGTAGGGATCAATAAAATTGTAGAAAAAATCCCAATTTTACATCATTTGAAC
TCTGAATGGCCAGTATATATCTTATTCAAAAAATCAATTTATCACAACAATTAAAGTATT
GTTAAATGCTGTGTAAAGTATTTCTTGAAAATGGAAGAAATAGATATTGATGATTTATAA
GACTTGATATATGACTATGCAGTGCCTATTTTAAATAACTGTTTATTTTACAATGATGCT
ACTCTAGATGCTGATAGTAAATTCTATAACGTTGTTTAAACTTTCTTTTTGAATGCCTAT
CAAAAAATACTCAAAAATTTAAAAGAAAAACTAGAATAGTCCAATTAAGCTCAAGAATAT
GAAGAATGTAGTAAAAAATTACTCAACCATCACTTAAAGAGATTGATCTAATCTGTTTGC
AAGCATATTGTTCACCCTTAGGCAGTTTGCGCCTTTTTATTAGTTTTTTCTAACTTGAAT
GAACAAAGCACCTCTATAAGTAGTGAAGAGATAAAAATGATATTAGACTTTACTCAAAGA
GTTTATGCAAGAGCAAACGTTAGAAAAAGAACTATTTTTGCTAAAGGGTTAATTTCATTA
ATTGTCAATCATTTAGATATTTAAAACATTGAAAATGAGTAAATTTATGATTTGATACTT
GGATTCCCTTAACAAACTTTCGAATGGATGAGCATCAAGCAATTTAATGGGCCTTAGCAT
TTAATTGAACTTGATTTAGTTAAAATAAATGAAGAAATAAACTCTTCATTTTAATACAAG
AGCAAATTATTGTATTTCTTGATAAAAAATGCTGAAAAATTAAACATCTCTTAGACTTTA
ATTGACTTAAGAAACAATATATCTTAGATTAAATTGTAAAATAATGAAGATTAACACTCG
TATTAAGATATGAATTAATAATATTTAAAATTCTTAAGTTTTACCAATATTTTACTAGAA
ATACCCTCTTATTCTCATGCAATTAAACATCTAATTGATAATTCTAAAGAAATTAAAAAA
GAATTAGAGTTCCTTTATTAGTTCTCTATTGATGGCAAATTAGCAGAATTTACTTCTTCT
TGGCTTTTTAATGACAAAATATCTGATATTTATACTAATTCTTATCGCCCTTACTAAGAA
AGTACTTAATATATTCTGCAATTAAAAGAATTGATAAAGCTATTTAAGGATACAAAGGAA
ATGAAAAAAATACATGAATAATTAGACTCTGTTAGTGCTGATCTTCTCAGTTATTTAATG
CTTAGAATATCAGAAAAGGATATTGATTCTAAATAATACTCTGATTTTTCTTACTACTAA
AATGAAATTTTAGATCTGTTCTTCAATTTGTACTATTATGCTATCTCTCCTCAATTGCTC
AGACCTACTCACAAATTATCTACTTCTCTATCTAAAGCTATTAAAAATATGTTTGAATAA
TTGATTTAACTTTTAAATAGATAAACTTCATAGTCACATTCAAACGAATCCATTCTATCA
CCTGGTGAAGAATAACTAGTGTGCCTTTACTTTGAAATTTTATCTTGTATCTGTAAGTCA
AATTTAGATATAATTTAATAATCACAAAAAAGTGCTAACAGTTCTATTTTTATTGATGAT
TTAATATTTGACAAGGGTTTGGAATTGGTTTAAATCCTATCCTTATATGACTCGCCTAGT
GATTAAAATTATCCAGTTATCAAATAGTTGGCTTCAAAGCGTGGGTTCTTATCTAAATCT
CATGCACTTCTTTGCAATTTAATGAGCTTGCTAAGCTTTAGCAACGAAATTTATAACAAC
CCTAATTTCACCAATATTATTGATAAAGTAGTTGCAGATGCATATTATCTTGCAGATGTC
TTTGATTTTAATAAATTAGATGAGCTCTTTATCATGTTGAAATATGTTTATAATCCTTAC
CTTGTAAGTCACCTCAATGATGAAAACTAAGAATAGCTTATTAAAGACTTTAAAAATCTT
TTTGAGTTATGTTTCAACCAAAATATTTTAACAACTTAATTAAATTACATAACTTATAAA
GAAGTTCACTATATGTACGAATGGGCTTTGGACCAAACACTATTTTACAATCCTTACATA
ATAAAATCTGACATTATTTAACATTTTATTAAGGTAACCTTGAAGGCAGGTTAAAATAAT
TGGTTACTATAGAGAAAAGTTGTGGATAAAATAGCTTCAATATTTTATTCTGACCCTTCT
TTACTTGTTTCTTTTGAGAAAACTATTTATAGATTCATCAAAATAAAAGAATATAGAGGA
TTTGATAATGGAATGGAGTTCTATAAAGATGAGTTAGAAATTCCTTTAGCAAATGAACTC
AAAACCAAATTTTCTAATAACATAGAATATTATGGAGCTTTCCCAAGATTTATGATACTA
AAACTATTAGAGAATATTGTTATCTGGATTAATAATTGTGTGAATAATCCTAGTGATTTA
TTAGATGAGGTTACTAAAGCTAAATTTAAAACTTTAATTGATTTTTATATAAAATATACA
TAAAATTTGTTAGAAAGAAATTACTAAAAGAAGTACTAAAAGTCAAGAAACTCACTTCTT
CCAAATACCAACCATTATAACTCAAAAATCCGTATGTGGCAGTGTCTCTGTGTTATTAAA
GATTTCTTTACTGAAAAAGTTATGAACTTCATTAAAAATACCTTTGATTAATCAGAGTAT
AATGTTGATAGACTTATATCTGACATCAAAGAAAAAATTTGGGGAATCTTAGATTTTAAC
AATTAAGTCAACATTAGACAATATATTGAAGTATTTACTCTTCACTTATACAATGAATTC
CCAGTTTATTTTGAATAGAGCATCATAGATGGAATCAAGGAAAAAAATAACAGATCTCAA
TACTCTATTCCCTTAGTTTTTATGGCTGGTTATCAATTATGCAGAAAACCAAATAATCTT
AAAGCCAAAGAAGTTTTATCTCATTTAATTCCATATACTGGATCACATGTTGCATATCTT
AGATCTATTGCATAGTACTTTGTTTCCAAATTCACTGAAGCTAATGAAGAACAAATTAAG
GATGATATTTTATTGAAGAATCTGAATTCATTTTTTACAGAAAACAAAGAATCCATAAAA
ATGAGAAAAACATTTGATAAAATTGTAGAAAAATTCCAAAAGGTTATTGAAAACTTTAAT
ACAGAGCAACTTTTGAGTATTGACATGGATGGAAATGGTGAGGTGGTTCACGAAAATGTG
ATTGAAGAAATAAAAAATGTTTGTATGAACTTGATATATTAATTAAAAGAACATGAAGAT
GCTCCTCCCAAAAAAGACGATTTATGGAGATTAAAAACTTAAGAATTCATTCAAGATATT
CCAATTCCTGATTTAAGTGAGGTTACAAACTTCTAGAGAAAAATTGATGTGGTTTAGAAT
GAACTAGATTAAATTGAAGCTGAAAAGAAAAAAAGGAGAAAAGAAAAAGACATCATAGTT
GTAGCATCATTGTTAGAAAAGATACCTAATTTCGGACACTTAACAAGAACTAGTGAAATT
TTCGGAGTCTCTTCATTGGTCATTCCTAATAAAGCAATTTTGGAAGAAGAAGGTTTCAAG
GCTATATCAGTTACAGCAGAGAAATGGCTTCCTATTTAAGAAGTAAAGGAAAAAGATCTT
ATGGCTTTCCTGATTCTTAAGAAAAAGCTTGGCTACAAAATTGTTGGATTAGAACAAACA
AGCAAAAGTAAGATGATACAACATTAAGAATTCCCTGATAAATGTATACTTCTTTTAGGA
AGAGAAAAAACAGGTATCCCTCTTGAGTATATTGAAATATTAGATGAATGTGTAGAGATT
CCTTAATTCGGATAAGTAAGATCTCTTAACGTTCATGTTAGTGCAGTTATTTGCATTTGG
GAGTTTGTCAAGTAAAAATTTATCAAAGAATGA


>TTHERM_00218280(protein)
MSIDVVLQSLIPKKATDDQTIYTLLKQYAVLQVSLKQNEQFSAEISQELNSVFQKNINDE
SIKNNAQFHRKYLFCLLYLYQQLKQNKIMVQIDVLQGLFEFSLSLSLTSTQINYYFVLKT
FNKILVKQGGEQINVMINEFLNAEIILESSVLQFYKTLKEKVEHADIESHHTQHLKKQEI
LIDFYIEYVQLNIKKGQFSQISESVQGVTKDIFKVYIWNEDTTSIFQKVCSSEANGFDFS
KYNVNSLYNANYFNKMREILFKYFRTLFQSQKSIQDNISSEFRKRYLQQRNNLSSQPDKQ
HNLLCFEVIKFVELLYFNRKYDLNDEIVKSEFYWSDLKNTLELYENFEACKQGVNALNGI
LESVQNRFNEKDIKNDKNLLEYSKIYTKKYKTFVDLYITLDSFAVHLIKSLWPQLANFFQ
KDPVGINKIVEKIPILHHLNSEWPVYILFKKSIYHNNQSIVKCCVKYFLKMEEIDIDDLQ
DLIYDYAVPILNNCLFYNDATLDADSKFYNVVQTFFLNAYQKILKNLKEKLEQSNQAQEY
EECSKKLLNHHLKRLIQSVCKHIVHPQAVCAFLLVFSNLNEQSTSISSEEIKMILDFTQR
VYARANVRKRTIFAKGLISLIVNHLDIQNIENEQIYDLILGFPQQTFEWMSIKQFNGPQH
LIELDLVKINEEINSSFQYKSKLLYFLIKNAEKLNISQTLIDLRNNISQIKLQNNEDQHS
YQDMNQQYLKFLSFTNILLEIPSYSHAIKHLIDNSKEIKKELEFLYQFSIDGKLAEFTSS
WLFNDKISDIYTNSYRPYQESTQYILQLKELIKLFKDTKEMKKIHEQLDSVSADLLSYLM
LRISEKDIDSKQYSDFSYYQNEILDLFFNLYYYAISPQLLRPTHKLSTSLSKAIKNMFEQ
LIQLLNRQTSQSHSNESILSPGEEQLVCLYFEILSCICKSNLDIIQQSQKSANSSIFIDD
LIFDKGLELVQILSLYDSPSDQNYPVIKQLASKRGFLSKSHALLCNLMSLLSFSNEIYNN
PNFTNIIDKVVADAYYLADVFDFNKLDELFIMLKYVYNPYLVSHLNDENQEQLIKDFKNL
FELCFNQNILTTQLNYITYKEVHYMYEWALDQTLFYNPYIIKSDIIQHFIKVTLKAGQNN
WLLQRKVVDKIASIFYSDPSLLVSFEKTIYRFIKIKEYRGFDNGMEFYKDELEIPLANEL
KTKFSNNIEYYGAFPRFMILKLLENIVIWINNCVNNPSDLLDEVTKAKFKTLIDFYIKYT
QNLLERNYQKKYQKSRNSLLPNTNHYNSKIRMWQCLCVIKDFFTEKVMNFIKNTFDQSEY
NVDRLISDIKEKIWGILDFNNQVNIRQYIEVFTLHLYNEFPVYFEQSIIDGIKEKNNRSQ
YSIPLVFMAGYQLCRKPNNLKAKEVLSHLIPYTGSHVAYLRSIAQYFVSKFTEANEEQIK
DDILLKNLNSFFTENKESIKMRKTFDKIVEKFQKVIENFNTEQLLSIDMDGNGEVVHENV
IEEIKNVCMNLIYQLKEHEDAPPKKDDLWRLKTQEFIQDIPIPDLSEVTNFQRKIDVVQN
ELDQIEAEKKKRRKEKDIIVVASLLEKIPNFGHLTRTSEIFGVSSLVIPNKAILEEEGFK
AISVTAEKWLPIQEVKEKDLMAFLILKKKLGYKIVGLEQTSKSKMIQHQEFPDKCILLLG
REKTGIPLEYIEILDECVEIPQFGQVRSLNVHVSAVICIWEFVKQKFIKE


>TTHERM_00218280(gene)
ATGAGCATAGACGTTGTTTTACAATCATTAATTCCAAAAAAGGCTACAGATGATTAAACA
ATTTACACTTTGCTGAAGTAGTATGCTGTTTTATAAGTTAGCTTAAAGCAAAATGAGTAA
TTTTCAGCAGAAATTAGCTAGGAGTTAAATAGTGTATTTTAGAAAAACATAAATGACGAA
TCTATAAAAAATAATGCGCAATTTCATAGAAAATATTTGTTTTGCCTCCTTTACTTGTAT
CAGCAACTCAAATAAAATAAAATTATGGTCTAAATAGATGTTTTACAAGGACTTTTTGAA
TTCTCTCTAAGTCTCAGTTTAACATCTACATAAATTAACTACTATTTTGGTAATAATTAA
ATGAATATTTTATTTTTTTAATAATTAAAATAGCTATGAACAAAAATAATTATTTTTTTT
AATGAAAAGTTCTAAAAACATTCAACAAAATTTTAGTGAAGTAAGGAGGAGAACAAATCA
ATGTGATGATAAATGAATTTTTAAATGCAGAAATTATTTTAGAAAGCTCTGTTTTGCAGT
TCTACAAAACTCTTAAAGAAAAAGTAGAACATGCAGATATAGAAAGTCACCATACTCAAC
ATCTTAAAAAGCAAGAAATATTGATAGATTTTTATATAGAGTATGTCTAACTCAACATTA
AAAAGGGGTAATTCTCCTAAATTAGTGAGTCCGTCCAAGGAGTTACAAAAGATATATTTA
AGGTCTACATTTGGAATGAAGATACAACTTCTATTTTCTAAAAAGTTTGCAGTAGTGAAG
CCAATGGTTTTGATTTTTCAAAATACAATGTTAATTCTCTTTATAATGCCAATTATTTTA
ATAAAATGAGAGAAATATTGTTCAAATACTTTAGGACACTATTTTAGTCATAAAAATCTA
TTCAAGATAACATCTCTAGTGTAAGTTTATTTTCTAAATAATACAATATAATTTTTTTTT
AAAGGAATTTAGAAAGAGGTATTTATAGTAGAGAAATAACCTTAGTAGCTAGCCTGATAA
ATAGCATAACTTACTTTGTTTTGAAGTTATTAAATTTGTAGAGCTCTTGTACTTCAATAG
AAAGTATGACTTAAATGATGAAATTGTTAAAAGCGAATTTTATTGGAGTGATTTGAAAAA
TACTCTCGAATTATATGAAAATTTCGAAGCCTGTAAACAAGGTGTTAATGCTTTAAATGG
TATTCTTGAATCAGTTTAAAATAGATTTAATGAAAAGGATATTAAAAATGATAAAAATCT
TTTGGAATATAGTAAAATTTACACAAAAAAGTATAAAACTTTTGTAGATCTTTACATAAC
ACTTGACAGTTTTGCAGTTCACTTGATTAAAAGCTTGTGGCCTCAATTAGCTAATTTCTT
TTAAAAAGATCCTGTAGGGATCAATAAAATTGTAGAAAAAATCCCAATTTTACATCATTT
GAACTCTGAATGGCCAGTATATATCTTATTCAAAAAATCAATTTATCACAACAATTAAAG
TATTGTTAAATGCTGTGTAAAGTATTTCTTGAAAATGGAAGAAATAGATATTGATGATTT
ATAAGACTTGATATATGACTATGCAGTGCCTATTTTAAATAACTGTTTATTTTACAATGA
TGCTACTCTAGATGCTGATAGTAAATTCTATAACGTTGTTTAAACTTTCTTTTTGAATGC
CTATCAAAAAATACTCAAAAATTTAAAAGAAAAACTAGAATAGTCCAATTAAGGTATTAT
ATTTGATTGATGATTTTGAATTTTTAATTATTTTTAAAAAACACAAACTTGTATTTTGGT
GAATAGTTTAGTTTATTTCATATCATTTTAATAATAATAAAATAGCTCAAGAATATGAAG
AATGTAGTAAAAAATTACTCAACCATCACTTAAAGAGATTGATCTAATCTGTTTGCAAGC
ATATTGTTCACCCTTAGGCAGTTTGCGCCTTTTTATTAGTTTTTTCTAACTTGAATGAAC
AAAGCACCTCTATAAGTAGTGAAGAGATAAAAATGATATTAGACTTTACTCAAAGAGTTT
ATGCAAGAGCAAACGTTAGAAAAAGAACTATTTTTGCTAAAGGGTTAATTTCATTAATTG
TCAATCATTTAGATATTTAAAACATTGAAAATGAGTAAATTTATGATTTGATACTTGGAT
TCCCTTAACAAACTTTCGAATGGATGAGCATCAAGCAATTTAATGGGCCTTAGCATTTAA
TTGAACTTGATTTAGTTAAAATAAATGAAGAAATAAACTCTTCATTTTAATACAAGAGCA
AATTATTGTATTTCTTGATAAAAAATGCTGAAAAATTAAACATCTCTTAGACTTTAATTG
ACTTAAGAAACAATATATCTTAGATTAAATTGTAAAATAATGAAGATTAACACTCGTATT
AAGATATGAATTAATAATATTTAAAATTCTTAAGTTTTACCAATATTTTACTAGAAATAC
CCTCTTATTCTCATGCAATTAAACATCTAATTGATAATTCTAAAGAAATTAAAAAAGAAT
TAGAGTTCCTTTATTAGTTCTCTATTGATGGCAAATTAGCAGAATTTACTTCTTCTTGGC
TTTTTAATGACAAAATATCTGATATTTATACTAATTCTTATCGCCCTTACTAAGAAAGTA
CTTAATATATTCTGCAATTAAAAGAATTGATAAAGCTATTTAAGGATACAAAGGAAATGA
AAAAAATACATGAATAATTAGACTCTGTTAGTGCTGATCTTCTCAGTTATTTAATGCTTA
GAATATCAGAAAAGGATATTGATTCTAAATAATACTCTGATTTTTCTTACTACTAAAATG
AAATTTTAGATCTGTTCTTCAATTTGTACTATTATGCTATCTCTCCTCAATTGCTCAGAC
CTACTCACAAATTATCTACTTCTCTATCTAAAGCTATTAAAAATATGTTTGAATAATTGA
TTTAACTTTTAAATAGATAAACTTCATAGTCACATTCAAACGAATCCATTCTATCACCTG
GTGAAGAATAACTAGTGTGCCTTTACTTTGAAATTTTATCTTGTATCTGTAAGTCAAATT
TAGATATAATTTAATAATCACAAAAAAGTGCTAACAGTTCTATTTTTATTGATGATTTAA
TATTTGACAAGGGTTTGGAATTGGTTTAAATCCTATCCTTATATGACTCGCCTAGTGATT
AAAATTATCCAGTTATCAAATAGTTGGCTTCAAAGCGTGGGTTCTTATCTAAATCTCATG
CACTTCTTTGCAATTTAATGAGCTTGCTAAGCTTTAGCAACGAAATTTATAACAACCCTA
ATTTCACCAATATTATTGATAAAGTAGTTGCAGATGCATATTATCTTGCAGATGTCTTTG
ATTTTAATAAATTAGATGAGCTCTTTATCATGTTGAAATATGTTTATAATCCTTACCTTG
TAAGTCACCTCAATGATGAAAACTAAGAATAGCTTATTAAAGACTTTAAAAATCTTTTTG
AGTTATGTTTCAACCAAAATATTTTAACAACTTAATTAAATTACATAACTTATAAAGAAG
TTCACTATATGTACGAATGGGCTTTGGACCAAACACTATTTTACAATCCTTACATAATAA
AATCTGACATTATTTAACATTTTATTAAGGTAACCTTGAAGGCAGGTTAAAATAATTGGT
TACTATAGAGAAAAGTTGTGGATAAAATAGCTTCAATATTTTATTCTGACCCTTCTTTAC
TTGTTTCTTTTGAGAAAACTATTTATAGATTCATCAAAATAAAAGTAATGAATTGAAATT
TGAATAGAAAATCTTATTTTAAATAATTTTTTTCTTAATTAGGAATATAGAGGATTTGAT
AATGGAATGGAGTTCTATAAAGATGAGTTAGAAATTCCTTTAGCAAATGAACTCAAAACC
AAATTTTCTAATAACATAGAATATTATGGAGCTTTCCCAAGATTTATGATACTAAAACTA
TTAGAGAATATTGTTATCTGGATTAATAATTGTGTGAATAATCCTAGTGATTTATTAGAT
GAGGTTACTAAAGCTAAATTTAAAACTTTAATTGATTTTTATATAAAATATACATAAAAT
TTGTTAGAAAGAAATTACTAAAAGAAGTACTAAAAGTCAAGAAACTCACTTCTTCCAAAT
ACCAACCATTATAACTCAAAAATCCGTATGTGGCAGTGTCTCTGTGTTATTAAAGATTTC
TTTACTGAAAAAGTTATGAACTTCATTAAAAATACCTTTGATTAATCAGAGTATAATGTT
GATAGACTTATATCTGACATCAAAGAAAAAATTTGGGGAATCTTAGATTTTAACAATTAA
GTCAACATTAGACAATATATTGAAGTATTTACTCTTCACTTATACAATGAATTCCCAGTT
TATTTTGAATAGAGCATCATAGATGGAATCAAGGAAAAAAATAACAGATCTCAATACTCT
ATTCCCTTAGTTTTTGTAAATAGTTTTTTTTTTATTTTTTAATAATTTTATCTTATTTAT
ATTAGATGGCTGGTTATCAATTATGCAGAAAACCAAATAATCTTAAAGCCAAAGAAGTTT
TATCTCATTTAATTCCATATACTGGATCACATGTTGCATATCTTAGATCTATTGCATAGT
ACTTTGTTTCCAAATTCACTGAAGCTAGTAAATAATTAATATTTAAATCAATAATTAATT
TAACTTAAACTTATCTCAAATAAGATGAAGAACAAATTAAGGATGATATTTTATTGAAGA
ATCTGAATTCATTTTTTACAGAAAACAAAGAATCCATAAAAATGAGAAAAACATTTGATA
AAATTGTAGAAAAATTCCAAAAGGTTATTGAAAACTTTAATACAGAGCAACTTTTGAGTA
TTGACATGGATGGAAATGGTGAGGTGGTTCACGAAAATGTGATTGAAGAAATAAAAAATG
TTTGTATGAACTTGATATATTAATTAAAAGAACATGAAGATGCTCCTCCCAAAAAAGACG
ATTTATGGAGATTGTAAAATAAATTCAACTGATATATTGTTAAATATTTTAATATTATCA
ATTAGAAAAACTTAAGAATTCATTCAAGATATTCCAATTCCTGATTTAAGTGAGGTTACA
AACTTCTAGAGAAAAATTGATGTGGTTTAGAATGAACTAGATTAAATTGAAGTATTTATT
TATTTATTCTTAATATTTCTAAAATATTAAACAAAAAATGTAAAATAAATAGGCTGAAAA
GAAAAAAAGGAGAAAAGAAAAAGACATCATAGTTGTAGCATCATTGTTAGAAAAGATACC
TAATTTCGGACACTTAACAAGAACTAGTGAAATTTTCGGAGTCTCTTCATTGGTCATTCC
TAATAAAGCAATTTTGGAAGAAGAAGGTTTCAAGGCTATATCAGTTACAGCAGAGAAATG
GCTTCCTATTTAAGAAGTAAAGGAAAAAGATCTTATGGCTTTCCTGATTCTTAAGAAAAA
GCTTGGCTACAAAGTAAATTTTAAGCATAAAAATAAACCTAAAATGATATTTAAAAATTA
AGATTGTTGGATTAGAACAAACAAGCAAAAGTAAGATGATACAACATTAAGAATTCCCTG
ATAAATGTATACTTCTTTTAGGAAGAGAAAAAACAGGTATCCCTCTTGAGTATATTGAAG
TAAATATTGTTCGTTCAATTCAATTATTCTAAAATAAATAAATTTAAAATAACTCTTTAA
ATATTTTTAATTAATTAGATATTAGATGAATGTGTAGAGATTCCTTAATTCGGATAAGTA
AGATCTCTTAACGTTCATGTTAGTGCAGTTATTTGCATTTGGGAGTTTGTCAAGTAAAAA
TTTATCAAAGAATGA