Identifiers and Description

Gene Model Identifier

TTHERM_00437560

Standard Name

TRM2 (TRNA Methyltransferase 2)

Aliases

PreTt05412 | 49.m00184 | 3708.m00034

Description

tRNA methyltransferase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02475 ) Met-10+ like-protein
  • ( PF05958 ) tRNA (Uracil-5-)-methyltransferase
  • ( TIGR02143 ) tRNA (uracil-5-)-methyltransferase
  • ( TIGR00479 ) 23S rRNA (uracil-5-)-methyltransferase RumA
  • ( TIGR02085 ) 23S rRNA (uracil-5-)-methyltransferase RumB
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR02469 ) precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00437560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12468.19.997093137033517e-262hypothetical protein (653 aa)
OxytrichaContig5027.0.g207.001811683013561e-96tRNA (Uracil-5-)-methyltransfe
rase
DictyBaseDDB_G02932449.996162112727537e-67DDB_G0293244 on chromosome: 6
position 2638704 to 2640881
Stentor CoeruleusSteCoe_352867.281290178321643e-33
WormBaseWBGene000192414.9976494746363024e-29status:Partially_confirmed U
niProt:Q9N5L0 protein_id:CCD
72437.1
SGDYKR056W0.000000000007000776811212012TRM2 tRNA methyltransferase, 5
-methylates the uridine residu
e at position 54 of tRNAs and
may also have a role in tRNA s
tabilization or maturation; en
do-exonuclease with a role in
DNA repair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00437560(coding)
ATGTAGAGATTTTTTAGTATATTAAATAAATAAACACTAATTAACAAATCTTTTGTTTCT
AAATTCATTGTATAAACCAATAAGTATACAAATACAGTTATTAATAAAATTAACTACTTG
AATTTTAGTAAACATATTTATTTTATGAGTACAAGTCCTTAAAAAGAAGACATTCTTTAG
CAAGAGAATGGTAGTGAATAGATATAGCAAGATGTCCTCTTAGGCAAGCGTAGTCTTCCT
AAAGATGCAATCACTGAAAATTAAGTTAAAGAAAACTTAGTTAAAGATGATGGAGATGTT
GCAATTGGAGATTAAGAAAATGCTGAAGCTGAAAATGATGATAACGATGATGAAAATGGA
TCTGAAAAAAGCGATGGAGAAGATATTTTTGAAAAAGATGATGTAGAACTTGAATGGGTT
TGTTTGAGAGGAGTTGAGAGATATGATTAAGAGAGATAAGTCTTAAAGATGCTTCATCGT
AATTTTGCAGATGAGAAATTCCAATTTACAAAAATTAGCAAACCAAAAAAGAAAAATATG
GCATTCATTTAATTCGCTAACACAGAAGAACGTAATCGCTTTATTTAATCTTTAAAAAAT
AAGAAGTTCTCTAAGAAGTAAAAACGCATGAAAGTACGTCCTGCATTTAAAGGAGATAGA
AATTTGAATGGAGGAGTAGCAGTTAGTCAATTAGAATAATAGAATAGTGCTTAACATTAA
CAATAATAACGTTAATAGCAACCTCCTAAATAAGCTTCTAAGGAAGATATTGAAAAGGAA
CTTTAAATCCCTCTTGAAGAGAGAGTTTGTCCTCTATGGAAAACTCCTTATGAAGAATAA
TTAGAAATCAAAAAGAAAGATTTTATTGAAATCATCAAAAATTTCCAAAAGCGTGCTAAA
GATAGCATAAGAAGCGATGAATCAACACCAATTTGGGTAACCCGTGAACCAAAAATAACA
GATTTTTTGGAGTGCGATGAATAATATAGATTCCATTATAGAAACAAGACTGAATTCACA
ATTGGTTTGAATCATTTAGGAGAAATAAAAGTTGGCTATAACCGCACAAATTTTGATAAG
GGTATTGCATTTATAGATGATGCTAATAAGAATTGTGTTTCTTCTAAAGAATCAGTGATT
CTTGCTTAACAACTTGAAAATTATATCAAGGAAACTGGACTTCCTGTATACGACAGATTT
GTCCATTAAGGATTTTGGAGATATTTTGTGGTAAGATAGAGCTTTAAGACAAAAGAAATC
CTGATAAATATTGTAGCTAAAGGCTCTTACTGCTCTGACGCTACTTAATTTGAATAAATT
AAATAAGGCTTGATAAAAATATTCCAAAAAGAAAGTCTTCCTGAAAACTTTGAATACAAT
ATAACATCAATAGGATTTTAATCATACGAAGCACCTTCTGACAGCATCCCCTAAGATGGA
TAGATTGATATAATTTATGGATCTAGATCATACAAAGAAAATATTCTAGGTAAAACATTT
GATATATCTGCTAATGCTTTCTTACAAGTTCATACACCTTAATGTGAGAGATTGTATAAG
TTGATAGGAAGCTTAACAGGAGAATTGAATGAAAAAACTATCTTTTTGGATATATGTTCT
GGTATTGGAACTATAGGTATTTGCTTAGCTAATTCTGCTAAGGAAGTTATTGGTATTGAA
ATGGTTGAAACCGCTTGCAATGATGCTAAAATTAATATAGAATAAAATGGAATTACAAAC
TATAAGGTAATTTGCTCAAAAGTTGAAGATGTGATTAATGAAATCGTTGGCCCTCTTGCC
GGATAATATAAAATTATTGGTGTTGTTGATCCTCCTAGACCTGGTCTTCATGCTAATGTA
GTTAAAGCTATGCGTACCTGTAAAGGTCTTGACCATTTAGTTTATGTTGCTTGTAACCCA
GTAGCTGTAACTGATAATTTATTAGCTTTATGCCTCCCTGAATCAAAGCGTAGAAGAGCA
CCAGCTTTTCATCTCACTAAATATTATGGATGTGATTTATTCCCATAAACAAAACATTTT
GAAGGTATCTTTTATTTGGAAAGATATCCTAATTATGATGAGTATAAATGA


>TTHERM_00437560(protein)
MQRFFSILNKQTLINKSFVSKFIVQTNKYTNTVINKINYLNFSKHIYFMSTSPQKEDILQ
QENGSEQIQQDVLLGKRSLPKDAITENQVKENLVKDDGDVAIGDQENAEAENDDNDDENG
SEKSDGEDIFEKDDVELEWVCLRGVERYDQERQVLKMLHRNFADEKFQFTKISKPKKKNM
AFIQFANTEERNRFIQSLKNKKFSKKQKRMKVRPAFKGDRNLNGGVAVSQLEQQNSAQHQ
QQQRQQQPPKQASKEDIEKELQIPLEERVCPLWKTPYEEQLEIKKKDFIEIIKNFQKRAK
DSIRSDESTPIWVTREPKITDFLECDEQYRFHYRNKTEFTIGLNHLGEIKVGYNRTNFDK
GIAFIDDANKNCVSSKESVILAQQLENYIKETGLPVYDRFVHQGFWRYFVVRQSFKTKEI
LINIVAKGSYCSDATQFEQIKQGLIKIFQKESLPENFEYNITSIGFQSYEAPSDSIPQDG
QIDIIYGSRSYKENILGKTFDISANAFLQVHTPQCERLYKLIGSLTGELNEKTIFLDICS
GIGTIGICLANSAKEVIGIEMVETACNDAKINIEQNGITNYKVICSKVEDVINEIVGPLA
GQYKIIGVVDPPRPGLHANVVKAMRTCKGLDHLVYVACNPVAVTDNLLALCLPESKRRRA
PAFHLTKYYGCDLFPQTKHFEGIFYLERYPNYDEYK


>TTHERM_00437560(gene)
CAAATAATATGTAGAGATTTTTTAGTATATTAAATAAATAAACACTAATTAACAAATCTT
TTGTTTCTAAATTCATTGTATAAACCAATAAGTATACAAATACAGTTATTAATAAAATTA
ACTACTTGAATTTTAGTAAACATATTTATTTTATGAGTACAAGTCCTTAAAAAGAAGACA
TTCTTTAGCAAGAGAATGGTAGTGAATAGATATAGCAAGATGTCCTCTTAGGCAAGCGTA
GTCTTCCTAAAGATGCAATCACTGAAAATTAAGTTAAAGAAAACTTAGTTAAAGATGATG
GAGATGTTGCAATTGGAGATTAAGAAAATGCTGAAGCTGAAAATGATGATAACGATGATG
AAAATGGATCTGAAAAAAGCGATGGAGAAGATATTTTTGAAAAAGATGATGTAGAACTTG
AATGGGTTTGTTTGAGAGGAGTTGAGAGATATGATTAAGAGAGATAAGTCTTAAAGATGC
TTCATCGTAATTTTGCAGATGAGAAATTCCAATTTACAAAAATTAGCAAACCAAAAAAGA
AAAATATGGCATTCATTTAATTCGCTAACACAGAAGAACGTAATCGCTTTATTTAATCTT
TAAAAAATAAGAAGTTCTCTAAGAAGTAAAAACGCATGAAAGTACGTCCTGCATTTAAAG
GAGATAGAAATTTGAATGGAGGAGTAGCAGTTAGTCAATTAGAATAATAGAATAGTGCTT
AACATTAACAATAATAACGTTAATAGCAACCTCCTAAATAAGCTTCTAAGGAAGATATTG
AAAAGGAACTTTAAATCCCTCTTGAAGAGAGAGTTTGTCCTCTATGGAAAACTCCTTATG
AAGAATAATTAGAAATCAAAAAGAAAGATTTTATTGAAATCATCAAAAATTTCCAAAAGC
GTGCTAAAGATAGCATAAGAAGCGATGAATCAACACCAATTTGGGTAACCCGTGAACCAA
AAATAACAGATTTTTTGGAGTGCGATGAATAATATAGATTCCATTATAGAAACAAGACTG
AATTCACAATTGGTTTGAATCATTTAGGAGAAATAAAAGTTGGCTATAACCGCACAAATT
TTGATAAGGGTATTGCATTTATAGATGATGCTAATAAGAATTGTGTTTCTTCTAAAGAAT
CAGTGATTCTTGCTTAACAACTTGAAAATTATATCAAGGAAACTGGACTTCCTGTATACG
ACAGATTTGTCCATTAAGGATTTTGGAGATATTTTGTGGTAAGATAGAGCTTTAAGACAA
AAGAAATCCTGATAAATATTGTAGCTAAAGGCTCTTACTGCTCTGACGCTACTTAATTTG
AATAAATTAAATAAGGCTTGATAAAAATATTCCAAAAAGAAAGTCTTCCTGAAAACTTTG
AATACAATATAACATCAATAGGATTTTAATCATACGAAGCACCTTCTGACAGCATCCCCT
AAGATGGATAGATTGATATAATTTATGGATCTAGATCATACAAAGAAAATATTCTAGGTA
ATTTAATCTCTTTAAGTTTGTCTTTTAATTTATTAACTGAATCAATTTTACTTATTTCTA
CTTATTGTTTATCTTTTGTTAGATTTAATCTTAAGGTAGACACTTTTCAGCAATCAATCT
TATAAAAATTTATTTAGTTTAAATAAAATTTATTGCAATGGAAAATAGATTCATAAAAAA
TTTAATTTTATCTAAAAACATTTTTTTTATTCAAATTTGAAAATATTTCCTTAATTAATT
ATATAAAATAAATATAAAGGTAAAACATTTGATATATCTGCTAATGCTTTCTTACAAGTT
CATACACCTTAATGTGAGAGATTGTATAAGTTGATAGGAAGCTTAACAGGAGAATTGAAT
GAAAAAACTATCTTTTTGGATATATGTTCTGGTATTGGAACTATAGGTATTTGCTTAGCT
AATTCTGCTAAGGAAGTTATTGGTATTGAAATGGTTGAAACCGCTTGCAATGATGCTAAA
ATTAATATAGAATAAAATGGAATTACAAACTATAAGGTAATATTTCAAAAAGTGTAATAG
TAGTTTTTAATAATTATTTTTTAAAAAAGGTAATTTGCTCAAAAGTTGAAGATGTGATTA
ATGAAATCGTTGGCCCTCTTGCCGGATAATATAAAATTATTGGTGTTGTTGATCCTCCTA
GACCTGGTCTTCATGCTAATGTAGTTAAAGCTATGCGTACCTGTAAAGGTCTTGACCATT
TAGTTTATGTTGCTTGTAACCCAGTAGCTGTAACTGATAATTTATTAGCTTTATGCCTCC
CTGAATCAAAGCGTAGAAGAGCACCAGCTTTTCATCTCACTAAATATTATGGATGTGATT
TATTCCCATAAACAAAACATTTTGAAGGTATCTTTTATTTGGAAAGATATCCTAATTATG
ATGAGTATAAATGAAAATTGTTTTATTTATTTATAACTAGATGTGTAGTAATTGAATTAG
AATAAAATTCTTATCAGCA