Identifiers and Description

Gene Model Identifier

TTHERM_00705190

Standard Name

TRM112 (tRNA methyltransferase 112)

Aliases

PreTt26874 | 111.m00095 | 3744.m00016

Description

tRNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00705190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17719.19.003714852256964e-78hypothetical protein (125 aa)
OxytrichaContig18162.0.g151.999981404597394e-31Trm112p-like protein
DictyBaseDDB_G02854899.998720540547892e-23DDB_G0285489 on chromosome: 4
position 3308405 to 3308952
SGDYNR046W9.997019043202629e-21TRM112 Subunit of tRNA methylt
ransferase (MTase) complexes i
n combination with Trm9p and T
rm11p; subunit of complex with
Mtq2p that methylates Sup45p
(eRF1) in the ternary complex
eRF1-eRF3-GTP; deletion confer
s resistance to zymocin
Stentor CoeruleusSteCoe_307800.00000000000009357622968840175
WormBaseWBGene000073120.000000000007996637300921877TRM112-like protein status:C
onfirmed UniProt:O45241 pr
otein_id:CAB03840.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00705190(coding)
ATGAGATTGCTTTCCCACAATTTACTCTAGTGCAACGTTAAAAATTGCAAATCAAATAAT
TTCCCCTTGAAGATTTAGGTCGATAAATCCAACATTATAAATTGCGAATTCCGTAAGGAA
CCTCTTGTTAAGCTCATTCCTAAATTAGATTGGAATGCCTTAGCTATTACTGTCCATAAT
CTTGCTAAGAATAAAGAATTCCCTGAAAAATTTAGCCCTGCTCTCTTAGATGATTAAAAG
TTTATGCAAGAATTACACAGAATTTTGATGGAAACTCATATTATTGAAGGTGCTTTAATC
TGTGAAGGTTGCAATAAGAGATATCCCATTAAAAATGGTATCCCCAACATGATTTTAAAT
GATGAAGAAGTTTGA


>TTHERM_00705190(protein)
MRLLSHNLLQCNVKNCKSNNFPLKIQVDKSNIINCEFRKEPLVKLIPKLDWNALAITVHN
LAKNKEFPEKFSPALLDDQKFMQELHRILMETHIIEGALICEGCNKRYPIKNGIPNMILN
DEEV


>TTHERM_00705190(gene)
ATGAGATTGCTTTCCCACAATTTACTCTAGTGCAACGTTAAAAATTGCAAATCAAATAAT
TTCCCCTTGAAGATTTAGGTCGATAAATCCAACATTATAAATTGCGAATTCCGTAAGGAA
CCTCTTGTTAAGCTCATTCCTAAATTAGATTGGAATGCCTTAGCTATTACTGTCCATAAT
GTAATAAATCTCATTTGAATCTAACAATAAAAGCACTTCATTGAAACAAGCTTTCACATT
TTTAGATTTAGCCGAATTCATTAAAATATAATTATTATTTATTTAAAACTAGCTTGCTAA
GAATAAAGAATTCCCTGAAAAATTTAGCCCTGCTCTCTTAGATGATTAAAAGTTTATGCA
AGAATTACACAGAATTTTGATGGAAGTAAAAAATAAATTTTGGTTTTCGTTTTAAAATAA
ACAATAATTAAGGTTTCTAAAGTCAAACTAACATTTTTTTTGCTGTAAAATAGACTCATA
TTATTGAAGGTGCTTTAATCTGTGAAGGTTGCAATAAGAGATATCCCATTAAAAATGGTA
TCCCCAACATGATTTTAAATGATGAAGAAGTTTGA