Identifiers and Description

Gene Model Identifier

TTHERM_00051970

Standard Name

TRM11 (tRNA methyltransferase)

Aliases

PreTt11377 | 3.m01656 | 3824.m03131

Description

homolog of the catalytic subunit of S. cerevisiae tRNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00051970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01568.19.997093137033517e-262hypothetical protein (584 aa)
OxytrichaContig16082.0.0.g991.999385218781115e-51Putative RNA methylase family
UPF0020
SGDYOL124C9.995528898049344e-31TRM11 Catalytic subunit of an
adoMet-dependent tRNA methyltr
ansferase complex (Trm11p-Trm1
12p), required for the methyla
tion of the guanosine nucleoti
de at position 10 (m2G10) in t
RNAs; contains a THUMP domain
and a methyltransferase domain
DictyBaseDDB_G02839692.0009605191578312e-25trmt11 on chromosome: 4 positi
on 1400103 to 1401870
WormBaseWBGene000221076.001696815660978e-24status:Partially_confirmed U
niProt:Q9N4H1 protein_id:CCD
73497.1
Stentor CoeruleusSteCoe_323755.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00051970(coding)
ATGAAGGTTTTAGCACAGTTTAAGACAATCCCTAATTATGTTGATTTCTGTTTGCCAGAA
TTAAAATCCTTGATTGCTATGCACAATCTCGATTGGAGAGAGGTTTTTAAGCACGAATTT
GTATAAGAAGGTCAAGAAAACTTAACTAACAATAATGACTTGATTAACACAAGTCCCTAC
TACCCTTACATGTACCACTAGAACAAGAAATTAAACCAAAAGAAATAGTTATTACCCATT
AGCGCCTCTGAAATTCGTCATACAAGCTTCAGACGTTTTCCTTTCGTGTATTTGGAATTC
CCTAATGTAGAAATATGCCAATAGATTATTTAGCGTTCAATTTTGATTGATGTTTTCATA
GAAATAATTTCTGAAGCAACTAATTATGAAGATATAGTTAAATTTGCAGACAAGGAAATT
CTATTTAAGCACAATTAGGAAGATTAAAAGATTCTATTCGAAGTTGATCCCTATAATTCC
CATCTTACATAATAGGAAATTATAGATCGTATTGAAATCATTACAGAATCTCTTAACATG
AGGGGTAAAATCGACCTTAAAAACCCCTAAAAGAAATTCTGGATCATGGAAAGACATGTT
GATCCTTTTACTAAATAGACTGATAGCTCGATTACTAACACTTTGCTTGACATTTACTTT
GGTGTTGAAATTGGAAGATCTAAATCTTGCACTCGTATCTCTCAAAAAGAAAACTAAACT
AACAAATATGACTTGAGATAGAGAGCCTATCTTGGACCTACTTCTACAGATAACATTCTT
TCCTTCTTAATGTGCAACTAGGGTCTTACTAGATCTGGAGATATGATCTTAGATCCTTTT
GTAGGCAGTGGATCACTTATTATTCCACCCTCCCACTTTGGCGCTATTTGCTTTGGTGGT
GATTTAGATCCTAGAGTGCTTCATGGATTTGGAGTAGGACGCTTAAACAAAAAGTCATAA
TTCTACTAAAAAAATGAGGAATATTGCAAGGAAATGAAGCCAAAAATTATGCTTAATTTC
GAATAGTATGAATTAAATAAGCCAAATATTATTCGTATGGATTGCATAAATACAAATTTA
AGAGAAGTTGAAATATTTGATGCAATCATTTGCGATCCTCCTTACGGTTTCCGTGCCATG
ACTAGAACTGCAGGAAAGAAAGAGAAGAAGAGAAATAGAAAAGATAAGCAAAGCACCAAT
GCTAATACTTAAGAAGATGAAGCTTAACATGAAGAAGATGATTAATAAACTGGATCTCCT
CTTCTAAAGCAGACTGAGTAAGCTAAAATAGTAGAAGAAATATCAAATTAAATGAATGGA
TTAGATATTGAAGGAAAAAACACTCAACCTAAAAATGAAGAAGAAGAAAAAAAAAATAAT
GAAAACGGCGAAGAAAGACATTCATACGCACCAACTCTTACAGTATCAGTTGATTACATT
GTGAATGGTCTCGTTAGATTAGCTAACAGAGTCCTAGCTCCTGGAGGTAGATTAGTATTC
CTATATCCTATTGAAAGAGAACATTACAATTCAACAGGCATAGAAAAATTAAACTATCCA
AACTTCACTCTCGTTGATTATTCAGAGAATCCCCTAAGCGAAAAGAAAAGTAGAATTTTG
GTAACACTTCAAAAGAACAAATCAGTTAAGGAATTTTTAGAAGAAGCAGGATACAAGAAT
CTAGATGAGATGAACGAATAAAATTAATTTTAAAATTAAACAGATTAATAATAATAATAA
TAATAACAATAAACTTAAGCTCAGTGA


>TTHERM_00051970(protein)
MKVLAQFKTIPNYVDFCLPELKSLIAMHNLDWREVFKHEFVQEGQENLTNNNDLINTSPY
YPYMYHQNKKLNQKKQLLPISASEIRHTSFRRFPFVYLEFPNVEICQQIIQRSILIDVFI
EIISEATNYEDIVKFADKEILFKHNQEDQKILFEVDPYNSHLTQQEIIDRIEIITESLNM
RGKIDLKNPQKKFWIMERHVDPFTKQTDSSITNTLLDIYFGVEIGRSKSCTRISQKENQT
NKYDLRQRAYLGPTSTDNILSFLMCNQGLTRSGDMILDPFVGSGSLIIPPSHFGAICFGG
DLDPRVLHGFGVGRLNKKSQFYQKNEEYCKEMKPKIMLNFEQYELNKPNIIRMDCINTNL
REVEIFDAIICDPPYGFRAMTRTAGKKEKKRNRKDKQSTNANTQEDEAQHEEDDQQTGSP
LLKQTEQAKIVEEISNQMNGLDIEGKNTQPKNEEEEKKNNENGEERHSYAPTLTVSVDYI
VNGLVRLANRVLAPGGRLVFLYPIEREHYNSTGIEKLNYPNFTLVDYSENPLSEKKSRIL
VTLQKNKSVKEFLEEAGYKNLDEMNEQNQFQNQTDQQQQQQQQQTQAQ


>TTHERM_00051970(gene)
ATGAAGGTTTTAGCACAGTTTAAGACAATCCCTAATTATGTTGATTTCTGTTTGCCAGAA
TTAAAATCCTTGATTGCTATGCACAATCTCGATTGGAGAGAGGTTTTTAAGCACGAATTT
GTATAAGAAGGTCAAGAAAACTTAACTAACAATAATGACTTGATTAACACAAGTCCCTAC
TACCCTTACATGTACCACTAGAACAAGAAATTAAACCAAAAGAAATAGTTATTACCCATT
AGCGCCTCTGAAATTCGTCATACAAGCTTCAGACGTTTTCCTTTCGTGTATTTGGAATTC
CCTAATGTAGAAATATGCCAATAGATTATTTAGCGTTCAATTTTGATTGATGTTTTCATA
GAAATAATTTCTGAAGCAACTAATTATGAAGATATAGTTAAATTTGCAGACAAGGAAATT
CTATTTAAGCACAATTAGGAAGATTAAAAGATTCTATTCGAAGTTGATCCCTATAATTCC
CATCTTACATAATAGGAAATTATAGATCGTATTGAAATCATTACAGAATCTCTTAACATG
AGGGGTAAAATCGACCTTAAAAACCCCTAAAAGAAATTCTGGATCATGGAAAGACATGTT
GATCCTTTTACTAAATAGACTGATAGCTCGATTACTAACACTTTGCTTGACGTAATTAAC
TACTTTTTGTTGTATTTTCCCTAGCTTCAAGATTAATAAACTACTTTTTATAACAATGAA
TAAGTTAAATTTATTCTCTTTGGAGATTACAGAGCCCAAATAAATTTATTTTACTCCTAA
AAGCAAAAGCTTCATAAGCAAATATTTTTAACATAAAATTTATTTTTACCTAAAAATAGT
ATTTTTTTTTTAAGTTCAAGAAAATCTTAGTATTTAAATGCAATTTCATTTAGTAGTTTA
TCTTTCTCATTTGCAGTTATGCAGTAGAGAAAGGAATGTTTAATACCTAAATATTCATTG
ATAGTATATTTAAAACTATTTTTTTTAAATAGATTTACTTTGGTGTTGAAATTGGAAGAT
CTAAATCTTGCACTCGTATCTCTCAAAAAGAAAACTAAACTAACAAATATGACTTGAGAT
AGAGAGCCTATCTTGGACCTACTTCTACAGATAACATTCTTTCCTTCTTAATGTGCAACT
AGGGTCTTACTAGATCTGGAGATATGATCTTAGATCCTTTTGTAGGCAGTGGATCACTTA
TTATTCCACCCTCCCACTTTGGCGCTATTTGCTTTGGTGGTGATTTAGATCCTAGAGTGC
TTCATGGATTTGGAGTAGGACGCTTAAACAAAAAGTCATAATTCTACTAAAAAAATGAGG
AATATTGCAAGGAAATGAAGCCAAAAATTATGCTTAATTTCGAATAGTATGAATTAAATA
AGCCAAATATTATTCGTATGGATTGCATAAATACAAATTTAAGAGAAGTTGAAATATTTG
ATGCAATCATTTGCGATCCTCCTTACGGTTTCCGTGCCATGACTAGAACTGCAGGAAAGA
AAGAGAAGAAGAGAAATAGAAAAGATAAGCAAAGCACCAATGCTAATACTTAAGAAGATG
AAGCTTAACATGAAGAAGATGATTAATAAACTGGATCTCCTCTTCTAAAGCAGACTGAGT
AAGCTAAAATAGTAGAAGAAATATCAAATTAAATGAATGGATTAGATATTGAAGGAAAAA
ACACTCAACCTAAAAATGAAGAAGAAGAAAAAAAAAATAATGAAAACGGCGAAGAAAGAC
ATTCATACGCACCAACTCTTACAGTATCAGTTGATTACATTGTGAATGGTCTCGTTAGAT
TAGCTAACAGAGTCCTAGCTCCTGGAGGTAGATTAGTATTCCTATATCCTATTGAAAGAG
AACATTACAATTCAACAGGCATAGAAAAATTAAACTATCCAAACTTCACTCTCGTTGATT
ATTCAGAGAATCCCCTAAGCGAAAAGAAAAGTAGAATTTTGGTAACACTTCAAAAGAACA
AATCAGTTAAGGAATTTTTAGAAGAAGCAGGATACAAGAATCTAGATGAGATGAACGAAT
AAAATTAATTTTAAAATTAAACAGATTAATAATAATAATAATAATAACAATAAACTTAAG
CTCAGTGA