Identifiers and Description

Gene Model Identifier

TTHERM_00636860

Standard Name

TRM1 (tRNA methyltransferase 1)

Aliases

PreTt19689 | 91.m00104

Description

N2,N2-dimethylguanosine tRNA methyltransferase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04032 ) RNAse P Rpr2/Rpp21 subunit domain
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF02005 ) N2,N2-dimethylguanosine tRNA methyltransferase
  • ( TIGR00308 ) N2,N2-dimethylguanosine tRNA methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00636860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03510.19.997093137033517e-262N2,N2-dimethylguanosine tRNA m
ethyltransferase (598 aa)
OxytrichaContig10417.0.g412.9996277075259347e-88N2,N2-dimethylguanosine tRNA m
ethyltransferase
DictyBaseDDB_G02845751.0001267035975107e-72DDB_G0284575 on chromosome: 4
position 2173651 to 2175465
WormBaseWBGene000066132.0007889996237956e-71locus:trm-1 tRNA (guanine(26
)-N(2))-dimethyltransferase
status:Confirmed UniProt:Q23
270 protein_id:CAB00881.1
SGDYDR120C6.9972728945133496e-59TRM1 tRNA methyltransferase; t
wo forms of the protein are ma
de by alternative translation
starts; localizes to both the
nucleus and mitochondrion to p
roduce the modified base N2,N2
-dimethylguanosine in tRNAs in
both compartments
Stentor CoeruleusSteCoe_110633.6251409191435593e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00636860(coding)
ATGTTAAAAAAAATCTTTAGCATAATTGGAAACTAATTAAACAAAAATAAATAAACAGTA
CTTCATAATCAAACTAATATTCAAGCAAAAAGGAGAACTTTTATTTTCGATTTTACAAAA
TATTTTAGAAAAATGGATAGCGAAGTTACAAACCAAATGTAAGTTGAGGAGGTTCCTTAA
TAGATAATTCAAGAAGAATCTAAATAGAATATTTAGTAGTAAATTACCAATTAACCAGTA
GATAATACCTTTATTTAGGAGGGATATGCTAAGATCTAAAAGTCTTACATTGAAAATTCA
GAAGATGGTAAAAAGTTGTTATCAGAAGTGTTCTACAACCCAGTTTAAGTTTTCAATAGA
GACTTAACTGTTTTGGTTATTCATATGTTCAAGGAATACTTAAAGGAAACTAGAAAGGAA
AAATTTGATGGAATAACTATTTTAGATGCTCTTTCTGCTAGTGGTCTTAGAGCAATTAGA
TTTAGCAAAGAACTTAAAGATATTAAGAAAGTCTATGCAAATGATATTTCCGAAGCATCC
CATAAGTTAATGATGGATAATTTCATATTGAACAATTTAGATCTTAGCAAAATTGAAATG
ACTTTAAAGGATGCCGTTTAGTTAATGTATGAATAAAAGTTCAGGAGCTCATCTGGAGAT
AGAAATGCTCGTTTTGATGTAATTGATTTAGATCCATATGGAACTTGTGCTCCATTCCTT
GACTGTGCCATTTAAGGCGCTGTTGGAGAAACATTACTATGCATTACTTCTACTGATTCT
AGAATCCTCTGTGGACCAGATACCTAAAAGTGCTACTATTTATATGGATCATCAAGAGCT
AAAATCGCTGCCTATGAAGAAAATGCAGTTAGAATTATTTTATATACAGCTAATAACATC
GCCAATAGATATGGAAAGTTTATTACACCTTTACTTTGTTACATGAGTGAATTTTATGTT
AGAGTCTTTCTTATAATCAAGCCTGGTAAACTTGAATGTGGAAGATCTTTAGTACGTACT
GGTAATGTTTTTCATTGTGATAACTGTTAGAATTAATACTTCCAAACATTTGGTAAGTAA
TCTAAGGCTAAGCAAAGTGATGCCCAAAAGCACGTTCCTTAAAAATTGAATCTTCCTAGC
AATATTTGCAATTAATGTGGAGAAAGCTTTACCATCAACGGACCTATTTGGACAGACAAA
TTGAATGATTAGGAATTCATCTAAAAAACTATTGATTATCTTAATTCAGATAAATTCGAT
TTACCTTTGGCTACTAAAAAGAAAATTGAAGGAATGTTGCACTCAATTTAGCTTGAGTAA
AAAGCTGGTGTTGATAATATTCCTTTAGGATTTAACTTTGAACACTTATCCAAGATGATG
AAAACTACAGTTCCAAGCAAAAAGAAAATTTTTTCAGCAATTAAAAGTTTAAATTATTCT
ATTGAATAAACATACTTAAATCCTGCTATATACAAAACAAATGCTCCTTCTGAAATAGTT
TTTGATGTTATCAGAAACTGGAAAAGAACCCTATAGCCAAATGATGAAGAATTCTTCAGG
GCATTTGATAAGGAAAGCTCTAATTATGCTATAGTCTCTAAACCAAACATATGCTAGCCC
AACTTCGATTTAGATATTAATGTTGAAAATAAACTACCAAGATGGCTTCCTAATCCAGAG
AAAAATTGGGGACCAGGAAAGAGACCTGCTCAAAAACTTCTAGTTGAAGAAGGATAAAAT
GAAGAAATCTAATAAGAACATTAGGATAATGGAGATGAATTAAAAAAGAAAAACAAAACA
GATTGA


>TTHERM_00636860(protein)
MLKKIFSIIGNQLNKNKQTVLHNQTNIQAKRRTFIFDFTKYFRKMDSEVTNQMQVEEVPQ
QIIQEESKQNIQQQITNQPVDNTFIQEGYAKIQKSYIENSEDGKKLLSEVFYNPVQVFNR
DLTVLVIHMFKEYLKETRKEKFDGITILDALSASGLRAIRFSKELKDIKKVYANDISEAS
HKLMMDNFILNNLDLSKIEMTLKDAVQLMYEQKFRSSSGDRNARFDVIDLDPYGTCAPFL
DCAIQGAVGETLLCITSTDSRILCGPDTQKCYYLYGSSRAKIAAYEENAVRIILYTANNI
ANRYGKFITPLLCYMSEFYVRVFLIIKPGKLECGRSLVRTGNVFHCDNCQNQYFQTFGKQ
SKAKQSDAQKHVPQKLNLPSNICNQCGESFTINGPIWTDKLNDQEFIQKTIDYLNSDKFD
LPLATKKKIEGMLHSIQLEQKAGVDNIPLGFNFEHLSKMMKTTVPSKKKIFSAIKSLNYS
IEQTYLNPAIYKTNAPSEIVFDVIRNWKRTLQPNDEEFFRAFDKESSNYAIVSKPNICQP
NFDLDINVENKLPRWLPNPEKNWGPGKRPAQKLLVEEGQNEEIQQEHQDNGDELKKKNKT
D


>TTHERM_00636860(gene)
ATGTTAAAAAAAATCTTTAGCATAATTGGAAACTAATTAAACAAAAATAAATAAACAGTA
CTTCATAATCAAACTAATATTCAAGCAAAAAGGAGAACTTTTATTTTCGATTTTACAAAA
TATTTTAGAAAAATGGATAGCGAAGTTACAAACCAAATGTAAGTTGAGGAGGTTCCTTAA
TAGATAATTCAAGAAGAATCTAAATAGAATATTTAGTAGTAAATTACCAATTAACCAGTA
GATAATACCTTTATTTAGGAGGGATATGCTAAGATCTAAAAGTCTTACATTGAAAATTCA
GAAGATGGTAAAAAGTTGTTATCAGAAGTGTTCTACAACCCAGTTTAAGTTAATAACATT
AACACAGCAGCATTAAATTCAAAATGAGCTGAGCTAATTTGCTTATTTTTATTAGCTGTT
TATAAATTTTTTATCATCTTACTAAAGACATTTTTAATTATGATCATTAGGTTTTCAATA
GAGACTTAACTGTTTTGGTTATTCATATGTTCAAGGAATACTTAAAGGAAACTAGTAATT
AAATTTTGGAATTATTGAATTAAAGATTCTTAAAATATTAAGATAAAAATATTTTAAATT
AAATTTAGGAAAGGAAAAATTTGATGGAATAACTATTTTAGATGCTCTTTCTGCTAGTGG
TCTTAGAGCAATTAGATTTAGCAAAGAACTTAAAGATATTAAGAAAGTCTATGCAAATGA
TATTTCCGAAGCATCCCATAAGTTAATGATGGATAATTTCATATTGAACAATTTAGATCT
TAGCAAAATTGAAAGTAAAAACATCTTTTACATATTTTTTAACTCATAATATTAAATAAA
ATTGAGGTAGATAAATTCTTATTTTATAAATTATATTTAAGTGACTTTAAAGGATGCCGT
TTAGTTAATGTATGAATAAAAGTTCAGGAGCTCATCTGGAGATAGAAATGCTCGTTTTGA
TGTAATTGATTTAGATCCATATGGAACTTGTGCTCCATTCCTTGACTGTGCCATTTAAGG
CGCTGTTGGAGAAACATTACTATGCATTACTTCTACTGATTCTAGAATCCTCTGTGGACC
AGATACCTAAAAGTGCTACTATTTATATGGATCATCAAGAGCTAAAATCGCTGCCTATGA
AGAAGTAACTTTTAGATATTTTAAGGAAATTTTGAGTTAAATAAATGTATTATTAATTAA
TATAGAATGCAGTTAGAATTATTTTATATACAGCTAATAACATCGCCAATAGATATGGAA
AGTTTATTACACCTTTACTTTGTTACATGAGTGAATTTTATGTTAGAGTCTTTCTTATAA
TCAAGCCTGGTAAACTTGAATGTGGAAGATCTTTAGTACGTACTGGTAATGTTTTTCATT
GTGATAACTGTTAGAATTAATACTTCCAAACATTTGGTAAGTAATCTAAGGCTAAGCAAA
GTGATGCCCAAAAGCACGTTCCTTAAAAATTGAATCTTCCTAGCAATATTTGCAATTAAT
GTGGAGAAAGCTTTACCATCAGTAAATATTTAGCTTTGTATTTATTAAAATATAAAAAGA
ATTAAATTATTTATATTAATTATAAAGACGGACCTATTTGGACAGACAAATTGAATGATT
AGGAATTCATCTAAAAAACTATTGATTATCTTAATTCAGATAAATTCGATTTACCTTTGG
CTACTAAAAAGAAAATTGAAGGAATGTTGCACTCAATTTAGCTTGTAAAAACTAAATAAT
TTTGCAATTTATATAATTTTTATTAATAATTTTATAGGAGTAAAAAGCTGGTGTTGATAA
TATTCCTTTAGGATTTAACTTTGAACACTTATCCAAGATGATGAAAACTACAGTTCCAAG
CAAAAAGAAAATTTTTTCAGCAATTAAAAGTTTAAATTATTCTATTGAATAAACATACTT
AAATCCTGCTATATACAAAACAAATGCTCCTTCTGAAATAGTTTTTGATGTTATCAGAAA
CTGGGTAAAAATATATTTTTTTACTCATTCATTTATTTTATTTATAAGTTTTAGAAAGCT
AAAAAATTAATTAAATATTATAAAACAGAAAAGAACCCTATAGCCAAATGATGAAGAATT
CTTCAGGGCATTTGATAAGGAAAGCTCTAATTATGCTATAGTCTCTAAACCAAACATGTA
TTTGCTTAAATTTTACATATAATTAAAATACTATTTATAATTAAAAAAAATAGATGCTAG
CCCAACTTCGATTTAGATATTAATGTTGAAAATAAACTACCAAGATGGCTTCCTAATCCA
GAGAAAAATTGGGGACCAGGAAAGAGACCTGCTCAAAAGTAATTTTTATATCTTTCTTAT
AAGAGCTTTAACTAATTTTACTATGAATTGTTCTATTAAAAAGACTTCTAGTTGAAGAAG
GATAAAATGAAGAAATCTAATAAGAACATTAGGATAATGGAGATGAATTAAAAAAGAAAA
ACAAAACAGATTGA