Identifiers and Description

Gene Model Identifier

TTHERM_00569420

Standard Name

TRF5 (Topoisomerase one-Related Function)

Aliases

PreTt10470 | 76.m00172 | 3810.m02033

Description

Related to Saccharomyces cerevisiae noncanonical poly(A) polymerase proteins TRF5 and PAP2 (TRF4)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00569420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03466.19.997093137033517e-262chitinase class I family prote
in (459 aa)
OxytrichaContig1080.1.g592.000364041471746e-45Cid1 family poly A polymerase
SGDYOL115W2.0008113830639685e-30PAP2 Non-canonical poly(A) pol
ymerase, involved in nuclear R
NA degradation as a component
of the TRAMP complex; catalyze
s polyadenylation of hypomodif
ied tRNAs, and snoRNA and rRNA
precursors; overlapping but n
on-redundant functions with Tr
f5p
DictyBaseDDB_G02957371.9993007828132465e-27DDB_G0295737 on chromosome: 5
position 3359151 to 3362061
WormBaseWBGene000141154.9988726541653934e-26locus:gld-4 Poly(A) RNA poly
merase gld-4 status:Confirme
d UniProt:G5EFL0 protein_i
d:CAB02138.3
Stentor CoeruleusSteCoe_300567.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00569420(coding)
ATGTCAGATAAAATGGATAAAATTTTGAAAGACTTAGATCTCACAAGTGGGTCTTAAAAG
AGAAAAATGAAAGATAGAGATTTAGAATAAGAATAAGGCGATTTAAGTAAAGAAATAATG
TAAAGCGCAGATAATTCATTCAAGATTGAGGATTAAACTTAAAAAAAAATAAAGATATCA
GATGATATTTAGGGAGATTATAATAATAATTAAGATGTAAATTAACAAGATGGTGTTTTA
GCAGAGAAAATAGGCGAATAGATAGTTTTTATAAACCTTGAAGAAAATAAATAGCAATAC
TAAAATAAACCTGTAGAAATAGATGACTTTTTATAGTTTGAGGAAAAATTAGATAAAAAG
GAAGCCGAAGAAGGTGATTTAAATATAGAACCAATTATTGGAAAGCAAGCAGATGAATAA
AAGGTAGCACCCTGGGCTTCTCTTAGAACTCTGCGTATTAAAAATCCTCTTTTGAGATTA
CATAATGAAATTATTGAGCTTACTGATTATTTATCACCTACCAAACAAGAGCATGAAATA
AGATTAAAGTCAATGGAAAGGCTCAAAAAAATTTTGTTAGATGCAGTTCCTGGATGTGAA
GTTAAAACCTTTGGTTCTTTCAGCACTGAATTATATCTACCTAACTCAGATATAGATATG
GTTATTGTGAAAGATGATATACAGAACAAATCTCTGTATAAAAAAGTAGCTGATAAAATA
ATGAATTGTGATGATATTTATGAAAATATAAATTTAGTTACTAATGCTAAGGTGCCTATT
ATCAAATTTGTTGAGAAGGAAACTTAAATCAATTTTGATATTTCTTTTAACAAAGAAGAT
GGTGTTAAATAATTATCAGAAGTTAAAAAAGGCTTAGAACTCTATCCTGAAATGAAATAC
CTGATTATGGTAATGAAATGCATTCTCAGATAAAGAGACTTGCATGAAACATATTCAGGT
GGTATTGGAAGTTTTCTGCTTTTCTGTATGATTCTTGCATTTTTAAGGGATCTTCGCAGA
CAATATGAAAAGGAAAATAGAGTTTAAGAAATACAAAATATTACCTTAGGAGAATATTTA
TTAAAAATGTTTAAATTTTATGGATTTTTTGATGTTGACAATAAAAGAATTATCATGCAT
GAAGGAGGTGAAGCACAATTCAAAATTTACATGATTGTTAATTAATTTTTACTTAAAATA
TATATTTAGGTGCAATTGTCGAAAAGGATATTAAAGATAAAAGATTTAGCTTACTTAGCC
CCTAGGATCCTACTCACGATATTGGAAATTCATCTTTCAAAATCAAAGAATAAGTTTTCC
CACTATTCAAAAATAGATTCTAATTCTTTACTAATTATAACTTCAAATAAGGCGAAAGCA
CTCTTAAATATTTAGTCAATCCATCTAACTCAACATTTACTTTCTAAAAGGAAGAAAAGT
GAAAATAAAAAATTTATCTATCCTCTAAACAATAAAGCCTTTTGA


>TTHERM_00569420(protein)
MSDKMDKILKDLDLTSGSQKRKMKDRDLEQEQGDLSKEIMQSADNSFKIEDQTQKKIKIS
DDIQGDYNNNQDVNQQDGVLAEKIGEQIVFINLEENKQQYQNKPVEIDDFLQFEEKLDKK
EAEEGDLNIEPIIGKQADEQKVAPWASLRTLRIKNPLLRLHNEIIELTDYLSPTKQEHEI
RLKSMERLKKILLDAVPGCEVKTFGSFSTELYLPNSDIDMVIVKDDIQNKSLYKKVADKI
MNCDDIYENINLVTNAKVPIIKFVEKETQINFDISFNKEDGVKQLSEVKKGLELYPEMKY
LIMVMKCILRQRDLHETYSGGIGSFLLFCMILAFLRDLRRQYEKENRVQEIQNITLGEYL
LKMFKFYGFFDVDNKRIIMHEGGEAQFKIYMIVNQFLLKIYIQVQLSKRILKIKDLAYLA
PRILLTILEIHLSKSKNKFSHYSKIDSNSLLIITSNKAKALLNIQSIHLTQHLLSKRKKS
ENKKFIYPLNNKAF


>TTHERM_00569420(gene)
GTAAATATTTCCCACTTAAATTAGTTTGAAAGATTTGTTATAAATTCAATTTTAGGTATC
ATTAATTTTGCTTTAAATTATCAAAAAATATATTTGTTTGATTTAATAGAATTAAGGCAA
CTAAAAATGTCAGATAAAATGGATAAAATTTTGAAAGACTTAGATCTCACAAGTGGTAAA
ATAATTTATAGATTAATATTATTTTAGCTGATATGATAAATATAATTATTAAGGGTCTTA
AAAGAGAAAAATGAAAGATAGAGATTTAGAATAAGAATAAGGCGATTTAAGTAAAGAAAT
AATGTAAAGCGCAGATAATTCATTCAAGATTGAGGATTAAACTTAAAAAAAAATAAAGAT
ATCAGATGATATTTAGGGAGATTATAATAATAATTAAGATGTAAATTAACAAGATGGTGT
TTTAGCAGAGAAAATAGGCGAATAGATAGTTTTTATAAACCTTGAAGAAAATAAATAGCA
ATACTAAAATAAACCTGTAGAAATAGATGACTTTTTATAGTTTGAGGAAAAATTAGATAA
AAAGGAAGCCGAAGAAGGTGATTTAAATATAGAACCAATTATTGGAAAGCAAGCAGATGA
ATAAAAGGTAGCACCCTGGGCTTCTCTTAGAACTCTGCGTATTAAAAATCCTCTTTTGAG
ATTACATAATGAAATTATTGAGCTTACTGATTATTTATCACCTACCAAACAAGAGCATGA
AATAAGATTAAAGTCAATGGAAAGGTAAAAAGTGACTGTATATTTGTATTATTTTGTTAG
TTGGAAAATAAATCCTTTTTTTAGCCTACTATCAATTCTTATTACTTAATAGTATAAAAT
CTTAAAATTTTAAACTGTGTATGATATTAATTAAAAATAATTTGCTTAAAGTAGAAGAAA
GTAAATAAATAAACAAAAAAACAAAAATCATATGTGCTTATTAAATAATCAATCTAATCC
AATTTAATTAAAAAATTTTATCCTATTTTAAATATAGGCTCAAAAAAATTTTGTTAGATG
CAGTTCCTGGATGTGAAGTTAAAACCTTTGGTTCTTTCAGCACTGAATTATATCTACCTA
ACTCAGATATAGATATGGTAAATTTTAAAATATATTTTAAGTTTAAAATAATTCACCTCC
AATTAATTATATTGAATTAATTTGTCGTCTAGAAAATATTTAGTGATTACAAATAATATG
AACATTAATTAAAATTTAAAAATAATTTGAATGTGATTGTAATTGATTTATAACTAATGA
AATTATTTTTTATAATAATATGAAAGGTTATTGTGAAAGATGATATACAGAACAAATCTC
TGTATAAAAAAGTAGCTGATAAAATAATGAATTGTGATGATATTTATGAAAATATAAATT
TAGTTACTAATGCTAAGGTGCCTATTATCAAATTTGTTGAGAAGGAAACTTAAATCAATT
TTGATATTTCTTTTAACAAAGAAGATGGTGTTAAATAATTATCAGAAGTTAAAAAAGGCT
TAGAACTCTATCCTGAAATGAAATACCTGATTATGGTAATGAAATGCATTCTCAGATAAA
GAGACTTGCATGAAACATATTCAGGTGGTATTGGAAGTTTTCTGCTTTTCTGTATGATTC
TTGCATTTTTAAGGGATCTTCGCAGACAATATGAAAAGGAAAATAGAGTTTAAGAAATAC
AAAATATTACCTTAGGAGAATATTTATTAAAAATGTTTAAATTTTATGGATTTTTTGATG
TTGACAATAAAAGAATTATCATGCATGAAGGAGGTGAAGCACAATTCAAAATTTACATGA
TTGTTAATTAATTTTTACTTAAAATATATATTTAGGTGCAATTGTCGAAAAGGATATTAA
AGATAAAAGATTTAGCTTACTTAGCCCCTAGGATCCTACTCACGATATTGGAAATTCATC
TTTCAAAATCAAAGAATAAGTTTTCCCACTATTCAAAAATAGATTCTAATTCTTTACTAA
TTATAACTTCAAATAAGGCGAAAGCACTCTTAAATATTTAGTCAATCCATCTAACTCAAC
ATTTACTTTCTAAAAGGAAGAAAAGTGAAAATAAAAAATTTATCTATCCTCTAAACAATA
AAGCCTTTTGATTTTGCTTTATTTGTTAAATAAATTTATGTTACATAGCTAATTTATTCG
TGTTTATTAAGGTAATTTAATTTTATTAAATATTTTCTA