Identifiers and Description

Gene Model Identifier

TTHERM_00979770

Standard Name

TRA2

Aliases

PreTt08276 | 183.m00026

Description

Co-purifies with SWC4 (TTHERM_00357110)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07620 ) SLEI
  • ( PF07813 ) LTXXQ motif
  • ( TIGR01612 ) rhoptry protein
  • ( PF08062 ) P120R (NUC006) repeat
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR00193 ) urease, gamma subunit
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF08311 ) Mad3/BUB1 homology region 1
  • ( PF06430 ) Lactococcus lactis RepB C-terminus
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF08876 ) Domain of unknown function (DUF1836)
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR00179 ) UDP-N-acetylenolpyruvoylglucosamine reductase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00979770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10138.19.997093137033517e-262hypothetical protein (4738 aa)
DictyBaseDDB_G02819479.998720540547892e-23tra1 on chromosome: 3 position
5137846 to 5151854
SGDYHR099W0.0000000000019997478866288316TRA1 Subunit of SAGA and NuA4
histone acetyltransferase comp
lexes; interacts with acidic a
ctivators (e.g., Gal4p) which
leads to transcription activat
ion; similar to human TRRAP, w
hich is a cofactor for c-Myc m
ediated oncogenic transformati
on
OxytrichaContig22731.0.g860.00000000019994075865167896hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00979770(coding)
ATGAGTTTCAAAGTGGATAAGGCAAAGGAAATCGTCTCAGATTTTCGAAATTTTTTTAGA
TTGAAACATTATTTATAGGAGGATCATATTAAAAATGCCATACAGTTTCTTGAAACAGAT
TTAGCAAATCACGAGATTGGAGGCGGAAATAACCCATAAAATAATAGTAGGGAGAGCAGC
AAGGTGTTTATAGAGATAGTTGATATATTTTTACCAGCTTACATGGAGATTTTAGAATAG
TCGCCTATGCAATATGAATATAATTAGGTGTAGCGCACTCGTTTATCAATATTAGAATTG
CTCAATAAATTTTTTGTTGTTAGAAATCAGTAGACAAATGTTCGTTTATATTCTTTATTA
TTAGATATTGTACGTAGAGACAATGAAACTAATGCAAATTGTGCTACTAAAATACTTCAA
GAATTCATAAAGTAGCTAGCAGAATAAATAAATAGTTAGCATGCAGGTTTAATTTAAAAA
ATGACAGAATTTAGCATAGAAAGCCTCTAAAGTGCATATGCAAGTCTTATTTAATTTTAA
TAACAGTAGCAGGAAGAAAAAATATAGTAATTATAGTAAGATGCAAATGGGATGCAAATA
GAAGAAAATAATTAAGATCAATAAGCAAGTGTTAATGGAAAATAGAATCAATCAAATAGG
CCAATGATTGATCATAAAATAGAGGATTTTCTCAATACTTTAATAGACATTGAAGATAAT
TATCCTAAATTAGAGCAGCTCACAGATGATGTTTATAAAGTGTTATGTGACAAGTCCAAA
CTTATTCAAGAATTAAGTTAAAACTATAAAGATCCTTAATTTAATATTTTAAAAGAATAA
AACGTACCTTCGTCTTCTTCTTCAAGCAAGAAAAATCCAAGATAGTAGCAACAATCTCAG
TCTTAGAGTTAAGTTAATTAGTAGCAACAATTAAGTTAAATATAATAGGGCTAGCAACAA
AATCAAGCAGATAAAATTATTCCCAGTCCTTTATCTTTATAGATTCTTAGTTAGCTTCCT
CATACTTTTATTACTATTGCAAATTTAGACTTGCAGCCTCTTTGTAAGATTTGCATGAAA
TTTTAAGCTATTAAGCAAAATGCTCTTCAAGAAAAAGATGAAAACAACTAAAACAACAAT
AATGTGAATTCTTCTGCTGCTTCTGCTATTGTTGAGGAAGGTAATTAGACAAATAGCAAC
AACAATGCAAGTCAATAAAATAGTCAACAAAAAAATTACAACTTTGAAAATTTTAATAAT
TAATTAGTCAAATAAACTAAAGAAATGATTAATAATGTCATCAAGGGGTTTTCCGATCTT
AAGATTTAGGAAATATATGAGGAGTTAGGCAAGAATGTTGCTCAAGAACTCATTATAGTG
CTTGCTAAAATGATTAAATTTTTTAGCGTTTTCATAAAGAAAAACGACGATTTTTCACAA
AGAGCTATTTTCAAAAATATGAATAAGCAAATGTTAGAATAAATTTTAGATACTGATAAA
GTTATTGAATGTGCCATTAACTTGGTTGATAAGTGCCCTGAGGAATTTTATACTTAAAGA
ATTGATACAATATCAAATTTGAAGAATCTTATAACACATAAGCAAGGCAAGCTAAAAGTG
AAGTATTGGTAATAGCTTTACCAAGAATAAAAAATAGTTGGAAGTGTTTAATTAATCAGT
ATTTACGGCAAGAACTAGTTGTAACATCAACTCATCGAATTGTATAAATAACTTAATTCG
GAGTTCTCTCGCTATTATGTAAGCTAAATTCAGCAACAATCTGTTCGCATAAATGATATC
ATGTAAATGCAGTAGATTATCTTTAATATGATTGAGACTTTAATAAAAAATATATTTGAT
AACTAATTGTATGTTTTTATGCAAGAAAAATCTCTTGAAATGCTAAGGGACGTTCTAAAA
CATTTCATTAATTTTGGTATTAATAGTAAGATTCCTAATGAAATTAAAGTCTTCAGACAT
AGTATTTTGATGAAAGTTGTGCATGCAATTTAAATGAAATACAAAGAAATTAAGAGAAAT
TTCTAATCTATAAAGCGTTTTATGAGTTAGTAAGAAGCTAGTCAGGGAAACAATCAGTAA
AGCTAAAATAAAAAAAATGATGGAAAAAAAGAGGATGAAGTGAATGACTAGTAAATGCAA
ATAGAAGAACCTCAGTTTTAAAAAAATGAAAGAGATAATTAATTCTCATAAAAAGAAGAG
AATAAAGAAAAAACAGTGACTTAACTTCATTTAAATTAGATGCCTATAGCTAATTTAGGC
GATTATGATGACATTGAGTGGAAGAAAAAGCGCATAGATTTTATTAAGAGCAATAATGTT
AACATAGAAAGCAATCTATAAAGTCTTCAACATTTATAATTCCACCACTTAGAAATTTAT
AATTAAAAGGAAACCCTTTTTTTTAATGGTATCAAGATAAAGAAAAATATAGACCGCTAA
TTTGTCAGAGATATTAAAAATAAAATTGTAGAATACCTAATTGAGTTGCAGAGAGACATT
TAAATTGTATTTTTCAATGAAAATAGAGAAGAAGAGTTCATCAATTTTACTCAAAAATAT
AAAAATGCAAATCCCAAGCAAATCGAACAAAGAAAAATGCAGTTAAGTATGTACAATACA
TTAAAGAAAGAATAAAGAAATATTTTTAGAAAAATCCTTAAAAACGGTTTAGAAGTTTTT
GAGTTCTTCCATGACTATGAGCACACCAACAGTAGATCTAATGATTATAGTTAATCAAGT
AAAAGGAACAATTTACTGTTTTTCATGTAAAATTTCGGTTTGATCAATGATAAAATATCA
TTCAAAGATATTTTTGAGCCGAATATGGACACAATTTTTAAGTATTTGTTGAAGTACAGT
GACTGCTCTGAAAACTGCATGAAAAATTTAATAATTGAACCTTTTGTTGTTATGGATAAG
TCGAAAATGTAAATGTAAATGCAAAATAATTAAACCATTGAAAACTCTCATTTAGCCTAA
ATATTAATTATTTATCTAATGCATAAATTGAATACCAACATAGAAAATATAGATCCCTTC
AGTCCTTTCTATGAATACAGAGATAAATATTTCACTCGCATATAAAGTATAATAAAAATC
CCTCTTCGAAGCTTCATTCGTCTCACTGATTACGAATTCGTTTATAGTTATTTTAGATAA
ATAATTATCTTCCTCATAAAAAAATCCCATACTTCACAATATCCATTAGAGTACTTATAA
ATCCTAAGGACCTTGTTTAAATGCTTTTTATCACCTGGTGAAAGAAGTCAATAACTAATC
GATAACCTTAATAATTAATTTTTCGGTATCTGTAATAAATCAGAGGATAATAGTTCCAAT
TCTTCGTCTTCTTCTTCATCTTCTTCATAATCTTCATCCTCATCTTCATAATCTTCTCTT
GCATAATAAGACACTTAATATCAAAATATTAACATTATTGAAAACCTAATTGCTCTTTAT
GACACTGATATTCACGAAGTTAAGGTAATAGTTTGTGAATTAATTCTTTTGCTCCCTCTT
AAAATTAGGCACATAGTTGCTAAAACTAAGATCATTGGCCGTCCTCTAGTTAAAGCTCTA
TCTCTCTTTGATTAGGCAAATACAGTTCGCTCTTTAAAAACAATAGAAAGCATATTAGGC
TATTGTACACATGAAGAAGCATAGCATTTGTTTATGGAAAACAAAGATGAATTAATGGAA
AAATTATATGAAATTATTTATGAATAAAGAATTATTGAAGAAGTAAGAAAGAAACCCCAT
CTCTATCCTGATACTCATTCAATTGATAAAAAAATATAAAACGACCCTGCAATAATTGCA
GTGAAGCTTCTTGGAAGGATGAATCATTTGACAAGATCAACAAAATTCTAAGAAAAGCTT
TAGAATGACATAAAAAATTAAGAATATCTTGACTAATTTTATATTAATATTGAAATGAAC
AATCCTTAATAGGATACTTTGAACCTCCCACTAAATGATGTCATTTTACATTCTATAGAT
ATATTTAATAAAATTATAGACAATTTCTACTGCCAGACTGTTCGAGGCAACTCAACACTA
GCCGCCTTTTGCATCCTTAAGATTACTTTATTTTAATTCTTCCCTGACTCATTATTTAAA
AATAGCTCCGTTTCTAGTTCATAAGCTGCTGATAATTTCTTCTAAAATGAAATGGAAAAT
GTTTTTGAAGAAAAAGATTAACCAACTAAAAAACTCTTTTAGGCTATCCACTAAGTGAAT
TAAAATGATCAAAAGATTTAAGAAAATGAAGGAATACTTGATAAGATATTAAAAATATTC
TTTGAAATAGTTGGAATTGATCAAAAGTTAACAACAGGTTTTTCTATCATAAACAGATTT
AAAAAAGAATCTTAAAAAATTTTAGAAATTCTGAATAAGACTATTTGTATTCTTTATAAG
ACTAATAAGGATGAAGCCTTAAAATATATTAAGGCAATAACTCTTAACGGTATCAGGAGT
GTTAAGATGAAAGTTATTTTAACAAGAGAAGAGTTACATATGTGCAAAGATTAAATTTGT
GGATAAATAGAATTTATTTAAAAATTCTTCAAGAATCAACAAGAATATCTTAAAGATGCA
GACAGAAATAGTTATGTTGAATTCTAAGATTTCTACTTGAAATCAATTTTAAAAGAGCTT
ATGAATACAACTAATTAAAACAAAATTTATGGTCTTCAAGTAATTTTACTTGACTTTATT
GAAGAATACATTAATGACCAAACTCTCCTCTAAAACTAGCAACAGAACGTTATTGAAATA
ATTAACACTATATTTATTATCTTAAACGAAATTCCTGACATAATTAATTTAAAAACAACT
AAAGTGTCTTCATAAATTCTTTCAAAGACTCTTAAATTCTTCCGCAAGCATAAAGATAAC
TTTGAAAGAATTGCTTGCAAGAAATTGATTGCTATATTTTTTAATAATTTATTAACATAT
AGAGAATTCGCTCATACTTTAGCTAAAGATTGTTTAGTTAATGCTTCATAAATCCATAAA
AAGAATTTAATAGATCTTTTTTACTGGAGAATGGATACTAGCGATTTTGAAGACTCACCA
TTCACTACAGGTAGTAATATGCTCGACTCACCTCATCTTAATTCTCAAAGCAGTAATGTC
AACAATTCTCAATCGTCATATACCTATAATGTAACTTAACATCCTATCAGTAAAATAATC
GAAAATATGCAAAATACTTTCCTTGGTTCTCTTCTTATGAAAATTAAAACTTCAATTTAA
AATTTCTCATTAACAAATAACAACTTTGAAAACATAAAATAAATGAAATACATTTCAAAT
GTTTACAAAACTTTAGAATTCTTAATCTGTATTGATTAAAATCGTCTTCCTTTCAGAGTG
CTTATTAATGATCCTCCTTAACAAATACCTCCTGAAGAATAAAATACATTTTTCAATGAA
AAGTACTACAAATTTGATCCTGATATTGTAAACATAATACAAAGCAGTGATATCATCATC
GCTACCAATACAGAAAAAATGTCCAAGCATGTCAAAATCATTATAGAAAATACCAAACCT
GCTAACTAACCTAATTAAACTGCCTAAAACGGAGCTAAGCCTAGTGAAGCTCCAGCATCT
AATGCCCCTCGTCCAAACAACGCTTCTACTAATGGTAATCCATCTAATCCTTCAAATCCT
GCATCCGGATCAACCTAACCTCCAGCAGCAGGAGCATCAACTCAAAGAGCTGGTAATAAT
GCTCCTGTTTAGAATACCTTTTAGATCAATCATTAGGTTTACTTAAATATAGAAGAATTC
GACTTGAATATTGAAGATATTGATCTTCGTATGAAGGAATAGTCAAATTTGATATAAAGC
ATATTAAGTTTTCTTAAAAGCTTATTACTGCTCAATCCTGTTAAGAAAGTAGCAAAGAGC
AACTTAAAGAATAGAGAAAAGAATTAGCAAGATCAAAGTGAAATTCTCAGCTATAGATAT
AAAATTATTTTAAAACTTTTTGGATAAATGACGAGAATAGAAAGAGGTATTAGCAGTACT
TCTTAAAGTTGCTTGCATGAAATGATTAACTAAGACTCTCACCCAAAGGAGCTTTTAAAT
AATGAAGATAAATTAAAGAGTATATTAAAGCCAGTGCTCATGTGCTTGTCGAATCATTTC
CATACATTCACACCTTCTTTCTTGTAGGTACTAAAGAAAATTTTGAAGCTTTTAACACCT
TGCTTTAATAAAGCACTCAGTGATAAGCTAACAACCCATTTAGATGATGTTACCAAAGAT
CCTAGTTAAAAATACAATATTTAATGCATTTCTGGACTTCTGAAGCTATTTTAATACTTA
TAGTATGCTTATTAGACTGCATATAACAATAATAATTAAGCTTCAAAGTAAAAAGAATAC
ATCAAAAAATCAATAGATACAATAATTTAAAATATCAATAAAATTGAGTAGTAATACTCA
TAGACAGAAGGCAAGTATTAGATCTAACAAATCACTCGTAAATCGCTTTGCAAATTTATG
AATTCGATGTCAGCTTAAGTTACCGAAAATTATTTCACAGAGACAGACCCAGAAATCCTA
AATCTTTTGTTAGAAATCTTAAAGCTCAATAAGGCTATGGTTGTTCGTGAAAGATTAACA
AGAGATAGCAATTAATCAGTAATTTAAAAGCTCTATAATAAGGGCAGAGAAAAAGAAAAT
AAGATAGTTTTCTTGAGAATAATAAAAAACTTAGGTTATAAAAATTGTAGATTGATGCTG
AATAACCAGTAAGGCGTAGAGTGTATCAAAGAAAGATTGACAGAAACTATCAAAATTTAT
AGAGATAAGACAATCACAGATAGTTCTATGCTATAAATTTAATAGATGAGCACAAAGAAT
GAGATTATTTATTATCTTAAAATTTTAGTGATTTACTGCTAATAAAAACACACAGATATT
GAAACTTTATTCAATTTAGCTGATTTCCTCAGCATACGTATGGCTCGTTATACTTATTTT
GTTTAAGACTTCTTTAATTACTACCTTCCTTACCACTACTCAGTCGAGCACAAAAAAGCT
ATCTATGAAAAATTCTTAGAATTTATCTTGTAAAATATGGAAAAAAAAGAAAAAGTTGAA
ACCATCATAAATATTTCTTATCACATTATATATCCTATGCTAGTACATTCCAATAAATTA
GGTCAAGTACCTTAAATAGTAGATAAGAAGAAATAAATTGAGTTCTTTGATAAACAGTTT
AAAATTCCTAAATTGATGTTCCCATATTACAGACTTGAAATGGAAATATTGTAGTTATCA
ACTTTGCTTCTATCTTATTTGAGATAAGATGTTATTTAATATAAGAAAGAATTCATTAGA
TTTGGATGGAAGTACATGAAATGTGAAGAAAAACTTCTGAAACACATAAGTTATGTTTAT
ACTTGTTAATTTATAACTTTGTTTGGAATGCCAGAAGAAATGATTTTCAGTATTTATGCT
TCTTTAATAAATAGAAAGCAAGACGATATTGTTGTTCAATAAGAAAATGAAATAGGATCA
CTTATCAAGAAAGCCCTAAATTTCTTGATTCCCTTCTTAGCTCAAAACAATTCCTAGAAC
AAATATAATGACTGGGTTAAATGGACAACAAATATCTTCAGTGACGATTCAAATTAGAAA
CATGCTATATTAATAAGATTTTGGCAAATTTTTATAAAAAATCACTAAATATTCCAGCAA
TATAGAAAATAATTCTCACCTCACATGATTAATTCTACATAATAGCTTATCATTTAAGCC
ACAAGATAAGCCAGTAGTTTTAATTCTCAAAATAAAATTGCTTGGGATTTGACTTTCCTT
TATATTGAATGGTCATTCATTGAGATGAAATCTATCTTAAAAAATACTGAAGTCTATGCT
AAATAGAAAAAGCTAAAGCAATTAGTAGAAAAAATAAAATAAAATTAAGCTTAAAATCAA
TAAAATGAAGGTAGTTCGACACCTAAATTCCAAATCGAAGAAGAGAGCATAAATGAAAAA
GAATTCGTGAAGAAAATAACTTCATAGCAACTAGTATAAAACTAAAACATTTTTTAAGAT
TAATTAAATGAAAATAAGGGAGAACCTATTTCATTTTCAAGATCGATGTAGCAAGCATCT
GAATAACCTAATTTTAATTCAGGAAACAATGAATAAGATTTCTTAAATAATAAATAAAAC
TTCGATAGCTAGTAATAATGTGAGAATATTTTACAATAGCAAAAAGAAATAATGCTAAAG
TACAACATAAGTGAAGAAGATATAGCCCTAACTGATGAAGAGATTTTAAATGCCTAAGTA
GAACTAGTAGAGAGATTCTCTGAAGAGATCGATTAAGGAGCAAAGGGTGTTATTATTCCA
TTTTATATAAAGTTAATTACCAATATTCTATAAACCTAAGATAGAGATAGAGATGAAAAG
AACTTCATCAAACGTACTTTATACCTTCTTAAAAAGACTTTTTTCATTTGGCCTAATATT
CAATAGAGAAATGAATACTATAAAACATAATTGTAAAGATTCACTAACAAATCATTTTCT
TCCTATTACTGTTAATTAAATATCTTAAGCATCATTCTTGAATTTGAGAGTAATGAAAAA
ATTCTAAATTTCCTTCCTACTGCATACAAGCTTTTGGATAGTAAACCAAATTAGCCAGCT
TAAGGACCTAACGGACCAACTCCTCAAGGAAACTAACCAGAAGCATCTTAACCACCAGTT
TCATAAAATAATCCGAATTAGAATTAAATTCCGTATCTTTTACAAATAGATAATCCTTAT
ACTGTACTTATACTTTCTACTATTTTCAAGAGGCTATTAAATACTGCCAATATTTACAAA
GAAAATGAATAGGCTGCAGAATTTTTCAGAAATGTTTAACAATTAGTGAAAGAAAGTATA
GAATAGCATGTCAAATATTTGCATCTTTTCAATTAATATAGAGTACCAAATCAGCCGATT
CCGCCACAAATATAAACCTAGTTAAATTAAATGAAGTAACAATAACCTATGAGTATTCAG
TTGTCTATCAAATTACTAAAGATTCTCTACTAACTAGATGATAAGGTTGATCTTGGGTTA
AGAAACATTAAAACACTTGTCTAATTTATGCTTGAAAAAGTAAAATCATGCAAATCTCCT
ATTGATGGCTACTACTTATTAACAAATTATAGCGAATATGATAGCAATACTGCAAATAAA
ATACTTAAAGTTCCTATTAAATAAACTTAAAATCAAAGCATAATTTAGGAATTCTCTGAA
GAATACGAAGAAACAATGTTATACTATGATGAAGTGTATGATAGTACTAAGATTAACTCT
ATTCATAATAAGTAGAACTTTATTACATTGCTACGTATTCTTGCTTTGAAGATTAATTCA
TTCAATGATAAAGATAATTAGGATATCACTTCAATCCTGAAGATGCTTGCTTCTTATTTA
GAGAAAATTTATGATTTAGATATCCGTATTGAAGCTGTTAATCTGCTGAAGTGCTTAATG
ATTGGAGAAAAGGCTTTCAAAAATAATACTCTACCTCTATAATACTAAAAAATTAAACAA
GTTAATTTATCAGCAGAGAAAAAGATGGAATTAATCATCGGCATATTCAATTACATAGCT
AGAATTTTTGACAAGAGATTCGGACTAACAAATCTCCAATTAAAGCTTACAAACACCTAT
CCTGATTCTGCTGCTGAATTTATGTCTCTGAAAGTAGCTGAAGAGTACATATCATAAGAA
TTTATGAGCTTCATAGTACACTCTATAAAAGAAAGTGGTATTAATAAATTAGATAGTGAT
TTTGTGAGATATCTCCTCTTATTATTTGTCAAAAACTCTTCTTCATTTGATTTAGCACTC
TTCTTCTAGCTTGCTGGAGATCTCTTCTGCACTAGCGACTTCAATTGTCTTCAGATGATT
TTAGGCTAATTCTAGAGTGAAAAGTGCTTAAAGAAGATTTTATCTGTTATTATCAACTAA
ATGTCAAAAGAATACAGCTTAGAAAATCTAGAATAAGATGAAGTGCTTCTCCTCGCATTT
AAGGTCATATTATTTAAAATTGTTGATTATGCTCCCAAGGTTAAAATTAAATTTGAAAGT
GATAATTATGAAGCTAATGAGCTGTCTGATGACTCTAAAAATGATAGCCTTAGTTTGGAA
TTGAAGCAATAATTTAAGGAGTTCTTCGAGTTGAAAGACTATTCACTCAATAAGAGAGAA
ATCATAGAATTATATTCTGAAATGATGACTTCAGCTTAAATTAAGCAAAGTCCAATAAAT
TCAATCGATGCTAATACAAACAGCTACATCTTTGTCTTATATCAACCTTAAGTATCATTT
AGCTGCCCAATCACTCCTCATCTTTTAATTCCTGCATTCAAAAAAGTCTTTAATTTTATG
GTTAAACTGAATCCCAAGCCTATTCAATTACGTCAACAAGCAATCTAACTATTTGAGCAG
TCTATCTTAAGACTGAACCCTTTCCCTCCAATTTTCAACAACTAGAAACAGTATATCTCT
TTATATTTTGTTTAAGCGTTAACAGAAATAATTATGGAAGAACTAGAAAATCCAACTGGA
TATATTATTCAACCTGAGAAATTATAGACTACATGCAGAGAGTATAATATATGGAGTTAT
GTTTAAATATATCTTGAAAAGATGCATTTTTAGAGAGACAAATATATCACTCAATTTAAA
TAGTATTCTCTTAAGAACTTCGAGACATCAAGTGTTCTAGATTAGCTTTCTTAAATAATA
GATGAGACTAACGAAAGTGATTATTCATATGGCTTAAAGTTCTACATGTCAAACAATTCC
TAATTAAAAAGAGCAATAGCAATTCAACAACAAAGAGAGTGGAATGATGCCTAAAATTTC
TTGATTGAGAAGAGAGCCCATATTTTCAATGATAATTAAGCTAAATTCAGTAAAGATAAT
GCTTCTTATTACTCAATATTAGAAGACTACTCTCACTTGATGGACTAAAGTATATATAAA
TCACTATTTATTGAGACTCAGAAAAATTTAAATAAGTGGGAAGACTTATACGAATACTCA
GAAAAGACCTAAAATATCTATTTATAATTGGAATGCATGTACAACACATCAAATATAACT
GGTATGAAGAAGGAAATAGCTAGATGCATTGAATATGGTTTGAGCATGGAGATTCCATTT
AGATATTATTGCTCTACTCTTATAGACTTCCAAAAGACTACAGATAGAGAAGATATTAAG
TAAGACTAAGGACATAATTTAACATATGCTTACTATTTAACTCTAAAAGACTGGACTAAA
TTTCCTAAAATGTTCTCTTCTGTTCATTTGAAACATTCATAGCAACTCCAATAATTAATA
GAGCTTGAAGAAGGTTTCCGTGTGAGAGATATGAGAGACTAGCAAATAACTCATCCTGCT
CAGATGATTGAATCTCTCGCTAAAAACACTTAAATGATGTTTAATTAATGGAGAGAGAGA
ATGCCACACAAGTATGAGAATTTGATAACTTGGAAAAATGTTGTTGATCAGAGAAATTTA
ATTTTGAATTCTATTAATGTTAGACTCAAAGATAGATTCAAAGGCTTGCTATAAAAGTTC
CTACAAATAAATTAACAAAGAAGAAATAATTTAGCTAATTAAAACTAACCATCAGAAAAT
AGTAATCCCAATCAGCCAGGAGGTCCTAGTAGTTCTAGCTCATAATCTTCTCTAAGCAGC
AGTTCTCTCTTATAGTTTGAAAGCTTTATTTAATCAATTCTTGAAGGAGACAAAGTAGAT
AAAATGTTAGCTTCATTTAGCGATCATCGTTGGAATACACTTAAATTCTTAAAAGTTTAA
AAATTATTTGGCAACTATACTATCGAAAAAATGCCAAATATTGATTAAAAGCTCCATCCT
GAAGAAATATATTTGAGGGCTAAGTTCTTAGCTAGCATTTACAAGGAGAACGAGTCTTAC
AACAACCTAAAATCTGCAATCGAAAGTCTCGAAAAGTTATCTCCTAAAGATTAAGACGAA
TTCAAAGTATACAAAGCAGATTTACTAAGAAAGAGAGCAATCTATTACTGGAACAATGAA
AAATATCTAGAAGCAACAGAAGATATGCAAAAAAGTATTTTAACTTGTGAAACTTATTAT
AAGACATGGAAGAGCTGGTTAGGAATATGCTTCTCTAATTATCTCAAACGTAAAAATTCT
GAGTACTGGGTTAGAAATTGTATGTAGCTCATTCCCCAGGCTTTAAAGTATAAAAGCTAT
AAGACTTAAATGATATTCAGTTACGCTTTCCTCATAATGCATTAAGACTAGTAATTCTTT
ATAGACAATATAAAATAAATTCAATCTGAATTGCCAAAACCCCAAATGCTAATGTGGCTT
CCAAATATGCTTTCAATTATACAAAATACTTCTACTCCTGAAATAATTGAAGTGTTTACC
AAAATAATAAATGATATTGCTGTTTACTATCCTTAACACGTATTTTATTATTTAAGGGGT
TTATTAGACTTATCTGTTACTTCTCAGTCTGTATCTCAAAACAGCAATACTACTTCCATA
AATAATGCTTAAATCTTAAAGATTTATAACAATTTAAGAACATGCTAAAATTCAGCTCTT
GTCAAGAAGTTAGAAACATTTGCAGACTTGGTAGCATAGCAATATTTCTAATCGCAACCT
TAATTTGAATTTGAAACTCTTCTTAATGAAATTAACAAGCTTCTTGAAGAGTTCTCTTCA
ATGAATCTTAATTCTAATCTTCCAGAATTCTATAAAAAAATAGTTCACACATTAACTGAA
GCTTCATAATACAGTTTCTTCGACAAAAATATAATCAATAAATAAGAATTTTCTGCTTAT
ATTTCTGACTTATAAAATAATCTGTTAAATTCCTAGTAAGCTATTTCCTTCTTAAGACTC
AAGATCTACTCTCCGATGCTCAAGTATTTTGTGAAGAACTATATAGATTAATAGAACCAA
ACTGCTTATTTCAACTCTGATTAATTACTCTCTCTTTCCTAAAATGTATAAGAAGTCGAG
CTACCTGGTTAATATAAAATACCATAAAATTCAAATGTCTTCAGAGATTTTGATTCTTCT
ACCCATTCGACTGTACTTTCTATCAACAAATCACTTATAATTGGGTTAAGTAATAGAAAG
ATCTAAAAGTAGATTGTCATCAATGCCTCTAACAATAAACAATATATTTATGAAGTGTTT
GATGCTAAGTAAGATGGAGATAAATGTAACACCTTCTAATAGAACTAATTGAAAATATTT
GCTATTCACTAGATGTAGGATATCATGAACATCTTGTTTAATCTCCATAAAGAAACAAAT
ATTCGCAACATGAGCATCAAAAACCCATAAAAATTCTCTCTTATGATGAGGGAGCAAACC
TAAACTTCTAAGGTTTACAAGAAAAATATGTAGATCATGTTAGTTCCAAGAGCACCTGTC
TTGCTAACATTTTAAGATATATATGATTAGTTCTTATCGAAGGATTCTAAATTAGAGGAA
GATAAGCTAAATATTCATTTAAATAATTTCAATTTAGAGAACTAATTGGAAGTCAATCAA
AATATGAAAAATATTGTTGGTAATAGTGTATTGTATGATCACATTATCAATAAAGTGAAT
GACTTAAATGACTTTATCTACATAAGAAAAGAATTCACTTATAATTATAGCTCAGCTATG
TTTTTCAATTATTTCATTGGATAATCTCTCAAAATTGAACATATATACTTAGATGCTTCT
AAAGGAACTGTTTATACAAACACCACTAATACAGAAGTTAACTCTAATAATAAATTAATT
TTAAAGAACCCTCATTCTATACGTATTTCTAGAAATATATCTAATTACATTAACGACATT
GGTATCTTGGGCATAGTAGCACCAACATTTATATCCATGGCAAAAGCAGTCACTCAACCT
AAGTATCCATTAAGAGAAGTTTGTATGCTATTCTTGAATGAATTATCTTTGGCTTTGGAT
TTAAAGGAAAATATTGCAAGTGACTCATTTGGTGATTAACTCAAGAAACTATATGATAAG
TTACTTTGGTTATATGTAGAAGACACAGAAAGAACATGGGCTAATATGGGATAAAAACTG
CAATAGGAATAGGAAAGCTAAATGTAAGTGGAGAATAGCGAATAAGAAAATCCTGTTCAT
AGCAAGACTAACAATGGATTTATTGATCCTATTTATCCAAGAGCTTACACTATAATAGAA
ACACTCGAATAAAGCTAGTAAAATAATAATAATAACCTTATTTATAAATACTGGTTCTGA


>TTHERM_00979770(protein)
MSFKVDKAKEIVSDFRNFFRLKHYLQEDHIKNAIQFLETDLANHEIGGGNNPQNNSRESS
KVFIEIVDIFLPAYMEILEQSPMQYEYNQVQRTRLSILELLNKFFVVRNQQTNVRLYSLL
LDIVRRDNETNANCATKILQEFIKQLAEQINSQHAGLIQKMTEFSIESLQSAYASLIQFQ
QQQQEEKIQQLQQDANGMQIEENNQDQQASVNGKQNQSNRPMIDHKIEDFLNTLIDIEDN
YPKLEQLTDDVYKVLCDKSKLIQELSQNYKDPQFNILKEQNVPSSSSSSKKNPRQQQQSQ
SQSQVNQQQQLSQIQQGQQQNQADKIIPSPLSLQILSQLPHTFITIANLDLQPLCKICMK
FQAIKQNALQEKDENNQNNNNVNSSAASAIVEEGNQTNSNNNASQQNSQQKNYNFENFNN
QLVKQTKEMINNVIKGFSDLKIQEIYEELGKNVAQELIIVLAKMIKFFSVFIKKNDDFSQ
RAIFKNMNKQMLEQILDTDKVIECAINLVDKCPEEFYTQRIDTISNLKNLITHKQGKLKV
KYWQQLYQEQKIVGSVQLISIYGKNQLQHQLIELYKQLNSEFSRYYVSQIQQQSVRINDI
MQMQQIIFNMIETLIKNIFDNQLYVFMQEKSLEMLRDVLKHFINFGINSKIPNEIKVFRH
SILMKVVHAIQMKYKEIKRNFQSIKRFMSQQEASQGNNQQSQNKKNDGKKEDEVNDQQMQ
IEEPQFQKNERDNQFSQKEENKEKTVTQLHLNQMPIANLGDYDDIEWKKKRIDFIKSNNV
NIESNLQSLQHLQFHHLEIYNQKETLFFNGIKIKKNIDRQFVRDIKNKIVEYLIELQRDI
QIVFFNENREEEFINFTQKYKNANPKQIEQRKMQLSMYNTLKKEQRNIFRKILKNGLEVF
EFFHDYEHTNSRSNDYSQSSKRNNLLFFMQNFGLINDKISFKDIFEPNMDTIFKYLLKYS
DCSENCMKNLIIEPFVVMDKSKMQMQMQNNQTIENSHLAQILIIYLMHKLNTNIENIDPF
SPFYEYRDKYFTRIQSIIKIPLRSFIRLTDYEFVYSYFRQIIIFLIKKSHTSQYPLEYLQ
ILRTLFKCFLSPGERSQQLIDNLNNQFFGICNKSEDNSSNSSSSSSSSSQSSSSSSQSSL
AQQDTQYQNINIIENLIALYDTDIHEVKVIVCELILLLPLKIRHIVAKTKIIGRPLVKAL
SLFDQANTVRSLKTIESILGYCTHEEAQHLFMENKDELMEKLYEIIYEQRIIEEVRKKPH
LYPDTHSIDKKIQNDPAIIAVKLLGRMNHLTRSTKFQEKLQNDIKNQEYLDQFYINIEMN
NPQQDTLNLPLNDVILHSIDIFNKIIDNFYCQTVRGNSTLAAFCILKITLFQFFPDSLFK
NSSVSSSQAADNFFQNEMENVFEEKDQPTKKLFQAIHQVNQNDQKIQENEGILDKILKIF
FEIVGIDQKLTTGFSIINRFKKESQKILEILNKTICILYKTNKDEALKYIKAITLNGIRS
VKMKVILTREELHMCKDQICGQIEFIQKFFKNQQEYLKDADRNSYVEFQDFYLKSILKEL
MNTTNQNKIYGLQVILLDFIEEYINDQTLLQNQQQNVIEIINTIFIILNEIPDIINLKTT
KVSSQILSKTLKFFRKHKDNFERIACKKLIAIFFNNLLTYREFAHTLAKDCLVNASQIHK
KNLIDLFYWRMDTSDFEDSPFTTGSNMLDSPHLNSQSSNVNNSQSSYTYNVTQHPISKII
ENMQNTFLGSLLMKIKTSIQNFSLTNNNFENIKQMKYISNVYKTLEFLICIDQNRLPFRV
LINDPPQQIPPEEQNTFFNEKYYKFDPDIVNIIQSSDIIIATNTEKMSKHVKIIIENTKP
ANQPNQTAQNGAKPSEAPASNAPRPNNASTNGNPSNPSNPASGSTQPPAAGASTQRAGNN
APVQNTFQINHQVYLNIEEFDLNIEDIDLRMKEQSNLIQSILSFLKSLLLLNPVKKVAKS
NLKNREKNQQDQSEILSYRYKIILKLFGQMTRIERGISSTSQSCLHEMINQDSHPKELLN
NEDKLKSILKPVLMCLSNHFHTFTPSFLQVLKKILKLLTPCFNKALSDKLTTHLDDVTKD
PSQKYNIQCISGLLKLFQYLQYAYQTAYNNNNQASKQKEYIKKSIDTIIQNINKIEQQYS
QTEGKYQIQQITRKSLCKFMNSMSAQVTENYFTETDPEILNLLLEILKLNKAMVVRERLT
RDSNQSVIQKLYNKGREKENKIVFLRIIKNLGYKNCRLMLNNQQGVECIKERLTETIKIY
RDKTITDSSMLQIQQMSTKNEIIYYLKILVIYCQQKHTDIETLFNLADFLSIRMARYTYF
VQDFFNYYLPYHYSVEHKKAIYEKFLEFILQNMEKKEKVETIINISYHIIYPMLVHSNKL
GQVPQIVDKKKQIEFFDKQFKIPKLMFPYYRLEMEILQLSTLLLSYLRQDVIQYKKEFIR
FGWKYMKCEEKLLKHISYVYTCQFITLFGMPEEMIFSIYASLINRKQDDIVVQQENEIGS
LIKKALNFLIPFLAQNNSQNKYNDWVKWTTNIFSDDSNQKHAILIRFWQIFIKNHQIFQQ
YRKQFSPHMINSTQQLIIQATRQASSFNSQNKIAWDLTFLYIEWSFIEMKSILKNTEVYA
KQKKLKQLVEKIKQNQAQNQQNEGSSTPKFQIEEESINEKEFVKKITSQQLVQNQNIFQD
QLNENKGEPISFSRSMQQASEQPNFNSGNNEQDFLNNKQNFDSQQQCENILQQQKEIMLK
YNISEEDIALTDEEILNAQVELVERFSEEIDQGAKGVIIPFYIKLITNILQTQDRDRDEK
NFIKRTLYLLKKTFFIWPNIQQRNEYYKTQLQRFTNKSFSSYYCQLNILSIILEFESNEK
ILNFLPTAYKLLDSKPNQPAQGPNGPTPQGNQPEASQPPVSQNNPNQNQIPYLLQIDNPY
TVLILSTIFKRLLNTANIYKENEQAAEFFRNVQQLVKESIEQHVKYLHLFNQYRVPNQPI
PPQIQTQLNQMKQQQPMSIQLSIKLLKILYQLDDKVDLGLRNIKTLVQFMLEKVKSCKSP
IDGYYLLTNYSEYDSNTANKILKVPIKQTQNQSIIQEFSEEYEETMLYYDEVYDSTKINS
IHNKQNFITLLRILALKINSFNDKDNQDITSILKMLASYLEKIYDLDIRIEAVNLLKCLM
IGEKAFKNNTLPLQYQKIKQVNLSAEKKMELIIGIFNYIARIFDKRFGLTNLQLKLTNTY
PDSAAEFMSLKVAEEYISQEFMSFIVHSIKESGINKLDSDFVRYLLLLFVKNSSSFDLAL
FFQLAGDLFCTSDFNCLQMILGQFQSEKCLKKILSVIINQMSKEYSLENLEQDEVLLLAF
KVILFKIVDYAPKVKIKFESDNYEANELSDDSKNDSLSLELKQQFKEFFELKDYSLNKRE
IIELYSEMMTSAQIKQSPINSIDANTNSYIFVLYQPQVSFSCPITPHLLIPAFKKVFNFM
VKLNPKPIQLRQQAIQLFEQSILRLNPFPPIFNNQKQYISLYFVQALTEIIMEELENPTG
YIIQPEKLQTTCREYNIWSYVQIYLEKMHFQRDKYITQFKQYSLKNFETSSVLDQLSQII
DETNESDYSYGLKFYMSNNSQLKRAIAIQQQREWNDAQNFLIEKRAHIFNDNQAKFSKDN
ASYYSILEDYSHLMDQSIYKSLFIETQKNLNKWEDLYEYSEKTQNIYLQLECMYNTSNIT
GMKKEIARCIEYGLSMEIPFRYYCSTLIDFQKTTDREDIKQDQGHNLTYAYYLTLKDWTK
FPKMFSSVHLKHSQQLQQLIELEEGFRVRDMRDQQITHPAQMIESLAKNTQMMFNQWRER
MPHKYENLITWKNVVDQRNLILNSINVRLKDRFKGLLQKFLQINQQRRNNLANQNQPSEN
SNPNQPGGPSSSSSQSSLSSSSLLQFESFIQSILEGDKVDKMLASFSDHRWNTLKFLKVQ
KLFGNYTIEKMPNIDQKLHPEEIYLRAKFLASIYKENESYNNLKSAIESLEKLSPKDQDE
FKVYKADLLRKRAIYYWNNEKYLEATEDMQKSILTCETYYKTWKSWLGICFSNYLKRKNS
EYWVRNCMQLIPQALKYKSYKTQMIFSYAFLIMHQDQQFFIDNIKQIQSELPKPQMLMWL
PNMLSIIQNTSTPEIIEVFTKIINDIAVYYPQHVFYYLRGLLDLSVTSQSVSQNSNTTSI
NNAQILKIYNNLRTCQNSALVKKLETFADLVAQQYFQSQPQFEFETLLNEINKLLEEFSS
MNLNSNLPEFYKKIVHTLTEASQYSFFDKNIINKQEFSAYISDLQNNLLNSQQAISFLRL
KIYSPMLKYFVKNYIDQQNQTAYFNSDQLLSLSQNVQEVELPGQYKIPQNSNVFRDFDSS
THSTVLSINKSLIIGLSNRKIQKQIVINASNNKQYIYEVFDAKQDGDKCNTFQQNQLKIF
AIHQMQDIMNILFNLHKETNIRNMSIKNPQKFSLMMREQTQTSKVYKKNMQIMLVPRAPV
LLTFQDIYDQFLSKDSKLEEDKLNIHLNNFNLENQLEVNQNMKNIVGNSVLYDHIINKVN
DLNDFIYIRKEFTYNYSSAMFFNYFIGQSLKIEHIYLDASKGTVYTNTTNTEVNSNNKLI
LKNPHSIRISRNISNYINDIGILGIVAPTFISMAKAVTQPKYPLREVCMLFLNELSLALD
LKENIASDSFGDQLKKLYDKLLWLYVEDTERTWANMGQKLQQEQESQMQVENSEQENPVH
SKTNNGFIDPIYPRAYTIIETLEQSQQNNNNNLIYKYWF


>TTHERM_00979770(gene)
ATGAGTTTCAAAGTGGATAAGGCAAAGGAAATCGTCTCAGATTTTCGAAATTTTTTTAGA
TTGAGTAAAATAATTTTATAGCATTTATCGTCTCATCATAGTCTTTTTAAACATCTTAAC
TTGAACAAAATTTGAGATTTACCTATGAATTTCAGTCCAAAATTTTTTTTAATTTTTCCT
CCTTTTCCTCTTTATTTATTGAATTATTATTAATGGCGGATAATTCTCATAAATTTAATG
AAATTGCAAGTAGGAGGCAAGGTTAATTAGTAAATTGGCTATAAAAGGAATTATATATAA
GTAATTAAGGGCATGATGAAGATAAATTGCGAAATGAATGAACTTAAAGCATTATTTTTT
GATAATTAATAAAAATAGAACATTATTTATAGGAGGATCATATTAAAAATGCCATACAGT
TTCTTGAAACAGATTTAGCAAATCACGAGATTGGAGGCGGAAATAACCCATAAAATAATA
GTAGGGAGAGCAGCAAGGTGTTTATAGAGATAGTTGATATATTTTTACCAGCTTACATGG
AGATTTTAGAATAGTCGCCTATGCAATATGAATATAATTAGGTGTAGCGCACTCGTTTAT
CAATATTAGAATTGCTCAATAAATTTTTTGTTGTTAGAAATCAGTAGACAAATGTTCGTT
TATATTCTTTATTATTAGATATTGTACGTAGAGACAATGAAACTAATGCAAATTGTGCTA
CTAAAATACTTCAAGAATTCATAAAGTAGCTAGCAGAATAAATAAATAGTTAGCATGCAG
GTTTAATTTAAAAAATGACAGAATTTAGCATAGAAAGCCTCTAAAGTGCATATGCAAGTC
TTATTTAATTTTAATAACAGTAGCAGGAAGAAAAAATATAGTAATTATAGTAAGATGCAA
ATGGGATGCAAATAGAAGAAAATAATTAAGATCAATAAGCAAGTGTTAATGGAAAATAGA
ATCAATCAAATAGGCCAATGATTGATCATAAAATAGAGGATTTTCTCAATACTTTAATAG
ACATTGAAGATAATTATCCTAAATTAGAGCAGCTCACAGATGATGTTTATAAAGTGTTAT
GTGACAAGTCCAAACTTATTCAAGAATTAAGTTAAAACTATAAAGATCCTTAATTTAATA
TTTTAAAAGAATAAAACGTACCTTCGTCTTCTTCTTCAAGCAAGAAAAATCCAAGATAGT
AGCAACAATCTCAGTCTTAGAGTTAAGTTAATTAGTAGCAACAATTAAGTTAAATATAAT
AGGGCTAGCAACAAAATCAAGCAGATAAAATTATTCCCAGTCCTTTATCTTTATAGATTC
TTAGTTAGCTTCCTCATACTTTTATTACTATTGCAAATTTAGACTTGCAGCCTCTTTGTA
AGATTTGCATGAAATTTTAAGCTATTAAGCAAAATGCTCTTCAAGAAAAAGATGAAAACA
ACTAAAACAACAATAATGTGAATTCTTCTGCTGCTTCTGCTATTGTTGAGGAAGGTAATT
AGACAAATAGCAACAACAATGCAAGTCAATAAAATAGTCAACAAAAAAATTACAACTTTG
AAAATTTTAATAATTAATTAGTCAAATAAACTAAAGAAATGATTAATAATGTCATCAAGG
GGTTTTCCGATCTTAAGATTTAGGAAATATATGAGGAGTTAGGCAAGAATGTTGCTCAAG
AACTCATTATAGTGCTTGCTAAAATGATTAAATTTTTTAGCGTTTTCATAAAGAAAAACG
ACGATTTTTCACAAAGAGCTATTTTCAAAAATATGAATAAGCAAATGTTAGAATAAATTT
TAGATACTGATAAAGTTATTGAATGTGCCATTAACTTGGTTGATAAGTGCCCTGAGGAAT
TTTATACTTAAAGAATTGATACAATATCAAATTTGAAGAATCTTATAACACATAAGCAAG
GCAAGCTAAAAGTGAAGTATTGGTAATAGCTTTACCAAGAATAAAAAATAGTTGGAAGTG
TTTAATTAATCAGTATTTACGGCAAGAACTAGTTGTAACATCAACTCATCGAATTGTATA
AATAACTTAATTCGGAGTTCTCTCGCTATTATGTAAGCTAAATTCAGCAACAATCTGTTC
GCATAAATGATATCATGTAAATGCAGTAGATTATCTTTAATATGATTGAGACTTTAATAA
AAAATATATTTGATAACTAATTGTATGTTTTTATGCAAGAAAAATCTCTTGAAATGCTAA
GGGACGTTCTAAAACATTTCATTAATTTTGGTATTAATAGTAAGATTCCTAATGAAATTA
AAGTCTTCAGACATAGTATTTTGATGAAAGTTGTGCATGCAATTTAAATGAAATACAAAG
AAATTAAGAGAAATTTCTAATCTATAAAGCGTTTTATGAGTTAGTAAGAAGCTAGTCAGG
GAAACAATCAGTAAAGCTAAAATAAAAAAAATGATGGAAAAAAAGAGGATGAAGTGAATG
ACTAGTAAATGCAAATAGAAGAACCTCAGTTTTAAAAAAATGAAAGAGATAATTAATTCT
CATAAAAAGAAGAGAATAAAGAAAAAACAGTGACTTAACTTCATTTAAATTAGATGCCTA
TAGCTAATTTAGGCGATTATGATGACATTGAGTGGAAGAAAAAGCGCATAGATTTTATTA
AGAGCAATAATGTTAACATAGAAAGCAATCTATAAAGTCTTCAACATTTATAATTCCACC
ACTTAGAAATTTATAATTAAAAGGAAACCCTTTTTTTTAATGGTATCAAGATAAAGAAAA
ATATAGACCGCTAATTTGTCAGAGATATTAAAAATAAAATTGTAGAATACCTAATTGAGT
TGCAGAGAGACATTTAAATTGTATTTTTCAATGAAAATAGAGAAGAAGAGTTCATCAATT
TTACTCAAAAATATAAAAATGCAAATCCCAAGCAAATCGAACAAAGAAAAATGCAGTTAA
GTATGTACAATACATTAAAGAAAGAATAAAGAAATATTTTTAGAAAAATCCTTAAAAACG
GTTTAGAAGTTTTTGAGTTCTTCCATGACTATGAGCACACCAACAGTAGATCTAATGATT
ATAGTTAATCAAGTAAAAGGAACAATTTACTGTTTTTCATGTAAAATTTCGGTTTGATCA
ATGATAAAATATCATTCAAAGATATTTTTGAGCCGAATATGGACACAATTTTTAAGTATT
TGTTGAAGTACAGTGACTGCTCTGAAAACTGCATGAAAAATTTAATAATTGAACCTTTTG
TTGTTATGGATAAGTCGAAAATGTAAATGTAAATGCAAAATAATTAAACCATTGAAAACT
CTCATTTAGCCTAAATATTAATTATTTATCTAATGCATAAATTGAATACCAACATAGAAA
ATATAGATCCCTTCAGTCCTTTCTATGAATACAGAGATAAATATTTCACTCGCATATAAA
GTATAATAAAAATCCCTCTTCGAAGCTTCATTCGTCTCACTGATTACGAATTCGTTTATA
GTTATTTTAGATAAATAATTATCTTCCTCATAAAAAAATCCCATACTTCACAATATCCAT
TAGAGTACTTATAAATCCTAAGGTAAATTATTTAAAAACTGTACTTTTAAATTGAAATAT
TGTTATTTATAATATTAAATAAATCATTTTATTTTAACCAAAAAAAACTTAAATATTAAA
TAAAATATTGTTTTTTGTTTGATCAAAACAAATAACAAATTTAAATTTTAATAATTAAAT
GATTTTATAAGAATTCAAGACAATAATTATTGGTAAAACAAAAAAAATTTTAAATATAGG
ACCTTGTTTAAATGCTTTTTATCACCTGGTGAAAGAAGTCAATAACTAATCGATAACCTT
AATAATTAATTTTTCGGTATCTGTAATAAATCAGAGGATAATAGTTCCAATTCTTCGTCT
TCTTCTTCATCTTCTTCATAATCTTCATCCTCATCTTCATAATCTTCTCTTGCATAATAA
GACACTTAATATCAAAATATTAACATTATTGAAAACCTAATTGCTCTTTATGACACTGAT
ATTCACGAAGTTAAGGTAATAGTTTGTGAATTAATTCTTTTGCTCCCTCTTAAAATTAGG
CACATAGTTGCTAAAACTAAGATCATTGGCCGTCCTCTAGTTAAAGCTCTATCTCTCTTT
GATTAGGCAAATACAGTTCGCTCTTTAAAAACAATAGAAAGCATATTAGGTAAAAGAATA
ATTTTAAACGTTTCTTGTTAAAATTGTTTCATCTATGAAAAATAATAGGCTATTGTACAC
ATGAAGAAGCATAGCATTTGTTTATGGAAAACAAAGATGAATTAATGGAAAAATTATATG
AAATTATTTATGAATAAAGAATTATTGAAGAAGTAAGAAAGAAACCCCATCTCTATCCTG
ATACTCATTCAATTGTAATTAATTAATTAATATAAAAAGTTTTTTTGATTATTAACATTT
TTATTATTTTTTAGGATAAAAAAATATAAAACGACCCTGCAATAATTGCAGTGAAGCTTC
TTGGAAGGATGAATCATTTGACAAGATCAACAAAATTCTAAGAAAAGCTTTAGAATGACA
TAAAAAATTAAGAATATCTTGACTAATTTTATATTAATATTGAAATGAACAATCCTTAAT
AGGATACTTTGAACCTCCCACTAAATGATGTCATTTTACATTCTATAGATATATTTAATA
AAATTATAGACAATTTCTACTGCCAGACTGTTCGAGGCAACTCAACACTAGCCGCCTTTT
GCATCCTTAAGATTACTTTATTTTAATTCTTCCCTGACTCATTATTTAAAAATAGCTCCG
TTTCTAGTTCATAAGCTGCTGATAATTTCTTCTAAGTACTTTCTATAAATTTCTCAACAA
ATATATATATCAAAATAAACTTTTATTAATTTTATATTTATTATTTGAATAGAATGAAAT
GGAAAATGTTTTTGAAGAAAAAGATTAACCAACTAAAAAACTCTTTTAGGCTATCCACTA
AGTGAATTAAAATGATCAAAAGATTTAAGAAAATGAAGGAATACTTGATAAGATATTAAA
AATATTCTTTGAAATAGTTGGAATTGATCAAAAGTTAACAACAGGTTTTTCTATCATAAA
CAGATTTAAAAAAGAATCTTAAAAAATTTTAGAAATTCTGAATAAGACTATTTGTATTCT
TTATAAGACTAATAAGGATGAAGCCTTAAAATATATTAAGGCAATAACTCTTAACGGTAT
CAGGAGTGTTAAGATGAAAGTTATTTTAACAAGAGAAGAGTTACATATGTGCAAAGATTA
AATTTGTGGATAAATAGAATTTATTTAAAAATTCTTCAAGAATCAACAAGAATATCTTAA
AGATGCAGACAGAAATAGTTATGTTGAATTCTAAGATTTCTACTTGAAATCAATTTTAAA
AGAGCTTATGAATACAACTAATTAAAACAAAATTTATGGTCTTCAAGTAATTTTACTTGA
CTTTATTGAAGAATACATTAATGACCAAACTCTCCTCTAAAACTAGCAACAGAACGTTAT
TGAAATAATTAACACTATATTTATTATCTTAAACGAAATTCCTGACATAATTAATTTAAA
AACAACTAAAGTGTCTTCATAAATTCTTTCAAAGACTCTTAAATTCTTCCGCAAGCATAA
AGATAACTTTGAAAGAATTGCTTGCAAGAAATTGATTGCTATATTTTTTAATAATTTATT
AACATATAGAGAATTCGCTCATACTTTAGCTAAAGATTGTTTAGTTAATGCTTCATAAAT
CCATAAAAAGAATTTAATAGATCTTTTTTACTGGAGAATGGATACTAGCGATTTTGAAGA
CTCACCATTCACTACAGGTAGTAATATGCTCGACTCACCTCATCTTAATTCTCAAAGCAG
TAATGTCAACAATTCTCAATCGTCATATACCTATAATGTAACTTAACATCCTATCAGTAA
AATAATCGAAAATATGCAAAATACTTTCCTTGGTTCTCTTCTTATGAAAATTAAAACTTC
AATTTAAAATTTCTCATTAACAAATAACAACTTTGAAAACATAAAATAAATGAAATACAT
TTCAAATGTTTACAAAACTTTAGAATTCTTAATCTGTATTGATTAAAATCGTCTTCCTTT
CAGAGTGCTTATTAATGATCCTCCTTAACAAATACCTCCTGAAGAATAAAATACATTTTT
CAATGAAAAGTACTACAAATTTGATCCTGATATTGTAAACATAATACAAAGCAGTGATAT
CATCATCGCTACCAATACAGAAAAAATGTCCAAGCATGTCAAAATCATTATAGAAAATAC
CAAACCTGCTAACTAACCTAATTAAACTGCCTAAAACGGAGCTAAGCCTAGTGAAGCTCC
AGCATCTAATGCCCCTCGTCCAAACAACGCTTCTACTAATGGTAATCCATCTAATCCTTC
AAATCCTGCATCCGGATCAACCTAACCTCCAGCAGCAGGAGCATCAACTCAAAGAGTATT
TTTTATATTTTAACATTTAATTGACTTTATACACACTTGTACCCAATAGCAGTATCATTC
CTATACCTTATTTATTAAAATTGATAATATTGATATAAGTTTTGAGTAAAATAAATAATA
AAAAAAAAATTAATGATTAAATTATAGCTATTTATTCTTAGCTATTTAAGTTTTTATTTC
CCAAAAATCCTTTAATTTGCTTGATTAATTTAATAAATTTTTTCTATTATATTAAAATAT
ATATCTAAATATTAAATAGGCTGGTAATAATGCTCCTGTTTAGAATACCTTTTAGATCAA
TCATTAGGTTTACTTAAATATAGAAGAATTCGACTTGAATATTGAAGATATTGATCTTCG
TATGAAGGAATAGTCAAATTTGATATAAAGCATATTAAGTTTTCTTAAAAGCTTATTACT
GCTCAATCCTGTTAAGAAAGTAGCAAAGAGCAACTTAAAGAATAGAGAAAAGAATTAGCA
AGATCAAAGTGAAATTCTCAGCTATAGATATAAAATTATTTTAAAACTTTTTGGATAAAT
GACGAGAATAGAAAGAGGTATTAGCAGTACTTCTTAAAGTTGCTTGCATGAAATGATTAA
CTAAGACTCTCACCCAAAGGAGCTTTTAAATAATGAAGATAAATTAAAGAGTATATTAAA
GCCAGTGCTCATGTGCTTGTCGAATCATTTCCATACATTCACACCTTCTTTCTTGTAGGT
ACTAAAGAAAATTTTGAAGCTTTTAACACCTTGCTTTAATAAAGCACTCAGTGATAAGCT
AACAACCCATTTAGATGATGTTACCAAAGATCCTAGTTAAAAATACAATATTTAATGCAT
TTCTGGACTTCTGAAGCTATTTTAATACTTATAGTATGCTTATTAGACTGCATATAACAA
TAATAATTAAGCTTCAAAGTAAAAAGAATACATCAAAAAATCAATAGATACAATAATTTA
AAATATCAATAAAATTGAGTAGTAATACTCATAGACAGAAGGCAAGTATTAGATCTAACA
AATCACTCGTAAATCGCTTTGCAAATTTATGAATTCGATGTCAGCTTAAGTTACCGAAAA
TTATTTCACAGAGACAGACCCAGAAATCCTAAATCTTTTGTTAGAAATCTTAAAGCTCAA
TAAGGTAATCAACTAATTAATATTCTTCAAATTAAAGTAATTATATATATATATAAAAAG
GCTATGGTTGTTCGTGAAAGATTAACAAGAGATAGCAATTAATCAGTAATTTAAAAGCTC
TATAATAAGGGCAGAGAAAAAGAAAATAAGATAGTTTTCTTGAGAATAATAAAAAACTTA
GGTTATAAAAATTGTAGATTGATGCTGAATAACCAGTAAGGCGTAGAGTGTATCAAAGAA
AGATTGACAGAAACTATCAAAATTTATAGAGATAAGACAATCACAGATAGTTCTATGCTA
TAAATTTAATAGATGAGCACAAAGAATGAGATTATTTATTATCTTAAAATTTTAGTGATT
TACTGCTAATAAAAACACACAGATATTGAAACTTTATTCAATTTAGCTGATTTCCTCAGC
ATACGTATGGCTCGTTATACTTATTTTGTTTAAGACTTCTTTAATTACTACCTTCCTTAC
CACTACTCAGTCGAGCACAAAAAAGCTATCTATGAAAAATTCTTAGAATTTATCTTGTAA
AATATGGAAAAAAAAGAAAAAGTTGAAACCATCATAAATATTTCTTATCACATTATATAT
CCTATGCTAGTACATTCCAATAAATTAGGTCAAGTACCTTAAATAGTAGATAAGAAGAAA
TAAATTGAGTTCTTTGATAAACAGTTTAAAATTCCTAAGTAATTTTCATAATTTGATATC
TTTTTTATCAAAAAATATTTATTATTTTAATTTTGAAATTTCCAAAAACTTAAATTTAAA
TTTTGAGATAAGTTATTTATGATAAAAAATTAACATATAGATTGATGTTCCCATATTACA
GACTTGAAATGGAAATATTGTAGTTATCAACTTTGCTTCTATCTTATTTGAGATAAGATG
TTATTTAATATAAGAAAGAATTCATTAGATTTGGATGGAAGTACATGAAATGTGAAGAAA
AACTTCTGAAACACATAAGTTATGTTTATACTTGTTAATTTATAACTTTGTTTGGAATGC
CAGAAGAAATGATTTTCAGTATTTATGCTTCTTTAATAAATAGAAAGCAAGACGATATTG
TTGTTCAATAAGAAAATGAAATAGGATCACTTATCAAGAAAGCCCTAAATTTCTTGATTC
CCTTCTTAGCTCAAAACAATTCCTAGAAGTAATCAAATTATTTTATCAATTACATTATTA
TAATTATATTTAAATAACAGCAAATATAATGACTGGGTTAAATGGACAACAAATATCTTC
AGTGACGATTCAAATTAGAAACATGCTATATTAATAAGATTTTGGCAAATTTTTATAAAA
AATCACTAAATATTCCAGCAATATAGAAAATAATTCTCACCTCACATGATTAATTCTACA
TAATAGCTTATCATTTAAGCCACAAGATAAGCCAGTAGTTTTAATTCTCAAAATAAAATT
GCTTGGGATTTGACTTTCCTTTATATTGAATGGTCATTCATTGAGATGAAATCTATCTTA
AAAAATACTGAAGTCTATGCTAAATAGAAAAAGCTAAAGCAATTAGTAGAAAAAATAAAA
TAAAATTAAGCTTAAAATCAATAAAATGAAGGTAGTTCGACACCTAAATTCCAAATCGAA
GAAGAGAGCATAAATGAAAAAGAATTCGTGAAGAAAATAACTTCATAGCAACTAGTATAA
AACTAAAACATTTTTTAAGATTAATTAAATGAAAATAAGGGAGAACCTATTTCATTTTCA
AGATCGATGTAGCAAGCATCTGAATAACCTAATTTTAATTCAGGAAACAATGAATAAGAT
TTCTTAAATAATAAATAAAACTTCGATAGCTAGTAATAATGTGAGAATATTTTACAATAG
CAAAAAGAAATAATGCTAAAGTACAACATAAGTGAAGAAGATATAGCCCTAACTGATGAA
GAGATTTTAAATGCCTAAGTAGAACTAGTAGAGAGATTCTCTGAAGAGATCGATTAAGGA
GCAAAGGGTGTTATTATTCCATTTTATATAAAGTTAATTACCAATATTCTATAAACCTAA
GATAGAGATAGAGATGAAAAGAACTTCATCAAACGTACTTTATACCTTCTTAAAAAGACT
TTTTTCATTTGGGTAAAATATTTATTTACTTTCATCTAACATTTTCATTAGAACTCAATT
ACTTTTCTAAAGTTATTTCACATAGTTAAAGCCAAAATAAATAAAGAATTTTGATCTAAA
AAAATAATTAAATACAAAAAATTAAAAAATATTTTGATAAAAATTAGCCTAATATTCAAT
AGAGAAATGAATACTATAAAACATAATTGTAAAGATTCACTAACAAATCATTTTCTTCCT
ATTACTGTTAATTAAATATCTTAAGCATCATTCTTGAATTTGAGAGTAATGAAAAAATTC
TAAATTTCCTTCCTACTGCATACAAGCTTTTGGATAGTAAACCAAATTAGCCAGCTTAAG
GACCTAACGGACCAACTCCTCAAGGAAACTAACCAGAAGCATCTTAGTAAATTTTAAGAT
AAAAGAAAATTAATTTTAAATAAAATTTTGTTAAATAGACCACCAGTTTCATAAAATAAT
CCGAATTAGAATTAAATTCCGTATCTTTTACAAATAGATAATCCTTATACTGTACTTATA
CTTTCTACTATTTTCAAGAGGCTATTAAATACTGCCAATATTTACAAAGAAAATGAATAG
GCTGCAGAATTTTTCAGAAATGTAAATAAAATTGTTAAAAAAATTACAAAAAAATAAATT
TTTATTTAATTATTATTTAAAAGGTTTAACAATTAGTGAAAGAAAGTATAGAATAGCATG
TCAAATATTTGCATCTTTTCAATTAATATAGAGTACCAAATCAGCCGATTCCGCCACAAA
TATAAACCTAGTTAAATTAAATGAAGTAACAATAACCTATGAGTATTCAGTTGTCTATCA
AATTACTAAAGATTCTCTACTAACTAGATGATAAGGTTGATCTTGGGTTAAGAAACATTA
AAACACTTGTCTAATTTATGCTTGAAAAAGTAAAATCATGCAAATCTCCTATTGATGGCT
ACTACTTATTAACAAATTATAGCGAATATGATAGCAATACTGCAAATAAAATACTTAAAG
TTCCTATTAAATAAACTTAAAATCAAAGCATAATTTAGGAATTCTCTGAAGAATACGAAG
AAACAATGTTATACTATGATGAAGTGTATGATAGTACTAAGATTAACTCTATTCATAATA
AGTAGAACTTTATTACATTGCTACGTATTCTTGCTTTGAAGATTAATTCATTCAATGATA
AAGATAATTAGGATATCACTTCAATCCTGAAGATGCTTGCTTCTTATTTAGAGAAAATTT
ATGATTTAGATATCCGTATTGAAGCTGTTAATCTGCTGAAGTGCTTAATGATTGGAGAAA
AGGCTTTCAAAAATAATACTCTACCTCTATAATACTAAAAAATTAAACAAGTTAATTTAT
CAGCAGAGAAAAAGATGGAATTAATCATCGGCATATTCAATTACATAGCTAGAATTTTTG
ACAAGAGATTCGGACTAACAAATCTCCAATTAAAGCTTACAAACACCTATCCTGATTCTG
CTGCTGAATTTATGTCTCTGAAAGTAGCTGAAGAGTACATATCATAAGAATTTATGAGCT
TCATAGTACACTCTATAAAAGAAAGTGGTATTAATAAATTAGATAGTGATTTTGTGAGAT
ATCTCCTCTTATTATTTGTCAAAAACTCTTCTTCATTTGATTTAGCGTAATTCAATTTTA
AATATTATTTAAGCTTTTTTCTCTAAATAAATTATTTTATTTTTCAATTAATAGACTCTT
CTTCTAGCTTGCTGGAGATCTCTTCTGCACTAGCGACTTCAATTGTCTTCAGATGATTTT
AGGCTAATTCTAGAGTGAAAAGTGCTTAAAGAAGATTTTATCTGTTATTATCAACTAAAT
GTCAAAAGAATACAGCTTAGAAAATCTAGAATAAGATGAAGTGCTTCTCCTCGCATTTAA
GGTCATATTATTTAAAATTGTTGATTATGCTCCCAAGGTTAAAATTAAATTTGAAAGTGA
TAATTATGAAGCTAATGAGCTGTCTGATGACTCTAAAAATGATAGCCTTAGTTTGGAATT
GAAGCAATAATTTAAGGAGTTCTTCGAGTTGAAAGACTATTCACTCAATAAGAGAGAAAT
CATAGAATTATATTCTGAAATGATGACTTCAGCTTAAATTAAGCAAAGTCCAATAAATTC
AATCGATGCTAATACAAACAGCTACATCTTTGTCTTATATCAACCTTAAGTATCATTTAG
CTGCCCAATCACTCCTCATCTTTTAATTCCTGCATTCAAAAAAGTCTTTAATTTTATGGT
TAAACTGAATCCCAAGCCTATTCAATTACGTCAACAAGCAATCTAACTATTTGAGCAGTC
TATCTTAAGACTGAACCCTTTCCCTCCAATTTTCAACAACTAGAAACAGTATATCTCTTT
ATATTTTGTTTAAGCGTTAACAGAAATAATTATGGAAGAACTAGAAAATCCAACTGGATA
TATTATTCAACCTGAGAAATTATAGACTACATGCAGAGAGTATAATATATGGAGTTATGT
TTAAATATATCTTGAAAAGATGCATTTTTAGAGAGACAAATATATCACTCAATTTAAATA
GTATTCTCTTAAGAACTTCGAGACATCAAGTGTTCTAGATTAGCTTTCTTAAATAATAGA
TGAGACTAACGAAAGTGATTATTCATATGGCTTAAAGTTCTACATGTCAAACAATTCCTA
ATTAAAAAGAGCAATAGCAATTCAACAACAAAGAGAGTGGAATGATGCCTAAAATTTCTT
GATTGAGAAGAGAGCCCATATTTTCAATGATAATTAAGCTAAATTCAGTAAAGATAATGC
TTCTTATTACTCAATATTAGAAGACTACTCTCACTTGATGGACTAAAGTATATATAAATC
ACTATTTATTGAGACTCAGAAAAATTTAAATAAGTGGGAAGACTTATACGAATACTCAGA
AAAGACCTAAAATATCTATTTATGTAAGCATTTTAAGATTTAACTAATTGTAATTTAATT
ATTTTTTTTCAAAAAAAGAATTGGAATGCATGTACAACACATCAAATATAACTGGTATGA
AGAAGGAAATAGCTAGATGCATTGAATATGGTTTGAGCATGGAGATTCCATTTAGATATT
ATTGCTCTACTCTTATAGACTTCCAAAAGACTACAGATAGAGAAGATATTAAGTAAGACT
AAGGACATAATTTAACATATGCTTACTATTTAACTCTAAAAGACTGGACTAAATTTCCTA
AAATGTTCTCTTCTGTTCATTTGAAACATTCATAGCAACTCCAATAATTAATAGAGCTTG
AAGAAGGTTTCCGTGTGAGAGATATGAGAGACTAGCAAATAACTCATCCTGCTCAGATGA
TTGAATCTCTCGCTAAAAACACTTAAATGATGTTTAATTAATGGTATAAAATATTTTTTT
TATCTTATCAAGTATAATATATATAATACTTCTTTTTTTAATAGGAGAGAGAGAATGCCA
CACAAGTATGAGAATTTGATAACTTGGAAAAATGTTGTTGATCAGAGAAATTTAATTTTG
AATTCTATTAATGTTAGACTCAAAGATAGATTCAAAGGCTTGCTATAAAAGTTCCTACAA
ATAAATTAACAAAGAAGAAATAATTTAGCTAATTAAAACTAACCATCAGAAAATAGTAAT
CCCAATCAGCCAGGAGGTCCTAGTAGTTCTAGCTCATAATCTTCTCTAAGCAGCAGTTCT
CTCTTATAGTTTGAAAGCTTTATTTAATCAATTCTTGAAGGAGACAAAGTAGATAAAATG
TTAGCTTCATTTAGCGATCATCGTTGGAATACACTTAAATTCTTAAAAGTTTAAAAATTA
TTTGGCAACTATACTATCGAAAAAATGCCAAATATTGATTAAAAGCTCCATCCTGAAGAA
ATATATTTGAGGGCTAAGTTCTTAGCTAGCATTTACAAGGAGAACGAGTCTTACAACAAC
CTAAAATCTGCAATCGAAAGTCTCGAAAAGTTATCTCCTAAAGATTAAGACGAATTCAAA
GTATACAAAGCAGATTTACTAAGAAAGAGAGCAATCTATTACTGGAACAATGGTAAAAAT
AATTAATTAAAATTAATTAAATGTTAATTTATTGAAATTAAAATATCATTTTTTTTAATT
AGAAAAATATCTAGAAGCAACAGAAGATATGCAAAAAAGTATTTTAACTTGTGAAACTTA
TTATAAGACATGGAAGAGCTGGTTAGGAATATGCTTCTCTAATTATCTCAAACGTAAAAA
TTCTGAGTACTGGGTTAGAAATTGTATGTAGCTCATTCCCCAGGCTTTAAAGTATAAAAG
CTATAAGACTTAAATGATATTCAGTTACGCTTTCCTCATAATGCATTAAGACTAGTAATT
CTTTATAGACAATATAAAATAAATTCAATCTGAATTGCCAAAACCCCAAATGCTAATGTG
GCTTCCAAATATGCTTTCAATTATACAAAATACTTCTACTCCTGAAATAATTGAAGTGTT
TACCAAAATAATAAATGATATTGCTGTTTACTATCCTTAACACGTATTTTATTATTTAAG
GGGTTTATTAGACTTATCTGTTACTTCTCAGTCTGTATCTCAAAACAGCAATACTACTTC
CATAAATAATGCTTAAATCTTAAAGATTTATAACAATTTAAGAACATGCTAAAATTCAGC
TCTTGTCAAGAAGTTAGAAACATTTGCAGACTTGGTAGCATAGCAATATTTCTAATCGCA
ACCTTAATTTGAATTTGAAACTCTTCTTAATGAAATTAACAAGCTTCTTGAAGAGTTCTC
TTCAATGAATCTTAATTCTAATCTTCCAGAATTCTATAAAAAAATAGTTCACACATTAAC
TGAAGCTTCATAATACAGTTTCTTCGACAAAAATATAATCAATAAATAAGAATTTTCTGC
TTATATTTCTGACTTATAAAATAATCTGTTAAATTCCTAGTAAGCTATTTCCTTCTTAAG
ACTCAAGATCTACTCTCCGATGCTCAAGTATTTTGTGAAGAACTATATAGATTAATAGAA
CCAAACTGCTTATTTCAACTCTGATTAATTACTCTCTCTTTCCTAAAATGTATAAGAAGT
CGAGCTACCTGGTTAATATAAAATACCATAAAATTCAAATGTCTTCAGAGATTTTGATTC
TTCTACCCATTCGACTGTACTTTCTATCAACAAATCACTTATAATTGGGTTAAGTAATAG
AAAGATCTAAAAGTAGATTGTCATCAATGCCTCTAACAATAAACAGTAAATTTTTATTAT
TTTTTATTCTAATAACAACAAAGCCTAATAAAAAAGAATTAATTTTTTACAACTTTTCTT
ATAAAAATTATTTTTAACAAAGTTAAAAGAATTTTAAAAGAAAATAACTTTATCTTTTTT
ATAAATTGCTATTAAAATATTTAACTTAAATTAAATAATTAAAGATATATTTATGAAGTG
TTTGATGCTAAGTAAGATGGAGATAAATGTAACACCTTCTAATAGAACTAATTGAAAATA
TTTGCTATTCACTAGATGTAGGATATCATGAACATCTTGTTTAATCTCCATAAAGAAACA
AATATTCGCAACATGAGCATCAAAAACCCATAAAAATTCTCTCTTATGATGAGGGAGCAA
ACCTAAACTTCTAAGGTTTACAAGAAAAATATGTAGATCATGTTAGTTCCAAGAGCACCT
GTCTTGCTAACATTTTAAGATATATATGATTAGTTCTTATCGAAGGATTCTAAATTAGAG
GAAGATAAGCTAAATATTCATTTAAATAATTTCAATTTAGAGAACTAATTGGAAGTCAAT
CAAAATATGAAAAATATTGTTGGTAATAGTGTATTGTATGATCACATTATCAATAAAGTG
AATGACTTAAATGACTTTATCTACATAAGAAAAGAATTCACTTATAATTATAGCTCAGCT
ATGTTTTTCAATTATTTCATTGGATAATCTCTCAAAATTGAACATATATACTTAGATGCT
TCTAAAGGAACTGTTTATACAAACACCACTAATACAGAAGTTAACTCTAATAATAAATTA
ATTTTAAAGAACCCTCATTCTATACGTATTTCTAGAAATATATCTAATTACATTAACGAC
ATTGGTATCTTGGGCATAGTAGCACCAACATTTATATCCATGGCAAAAGCAGTCACTCAA
CCTAAGTACATAATCAATTATTTTCTTTTTTTTAAATTGATTTTTCAAATTAAAAAATAA
CATTTTAATTAAAAAAATAAAAAGGTATCCATTAAGAGAAGTTTGTATGCTATTCTTGAA
TGAATTATCTTTGGCTTTGGATTTAAAGGAAAATATTGCAAGTGACTCATTTGGTGATTA
ACTCAAGAAACTATATGATAAGTTACTTTGGTTATATGTAGAAGACACAGAAAGAACATG
GGCTAATATGGGATAAAAACTGCAATAGGAATAGGAAAGCTAAATGTAAGTGGAGAATAG
CGAATAAGAAAATCCTGTTCATAGCAAGACTAACAATGGATTTATTGATCCTATTTATCC
AAGAGCTTACACTATAATAGAAACACTCGAATAAAGCTAGTAAAATAATAATAATAACCT
TATTTATAAATACTGGTTCTGA