Identifiers and Description

Gene Model Identifier

TTHERM_00978770

Standard Name

TRA1

Aliases

PreTt08275 | 183.m00025

Description

Co-purifies with SWC4 (TTHERM_00357110)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF02524 ) KID repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF04554 ) Extensin-like region
  • ( TIGR01257 ) rim ABC transporter
  • ( PF04499 ) SIT4 phosphatase-associated protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF06600 ) Protein of unknown function (DUF1140)
  • ( TIGR00156 ) conserved hypothetical protein TIGR00156
  • ( TIGR00213 ) D,D-heptose 1,7-bisphosphate phosphatase
  • ( TIGR00136 ) tRNA uridine 5-carboxymethylaminomethyl modification enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 50.2%

TetraMine Data

TTHERM_00978770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10141.19.997093137033517e-262hypothetical protein (4699 aa)
WormBaseWBGene000131380.0000000000008001317446409227status:Partially_confirmed U
niProt:Q9XW47 protein_id:CAA
22144.3
OxytrichaContig22731.0.g860.0000000020002373268528243hypothetical protein
SGDYHR099W0.000000019990673443141236TRA1 Subunit of SAGA and NuA4
histone acetyltransferase comp
lexes; interacts with acidic a
ctivators (e.g., Gal4p) which
leads to transcription activat
ion; similar to human TRRAP, w
hich is a cofactor for c-Myc m
ediated oncogenic transformati
on
DictyBaseDDB_G02819470.0000029996948234116693tra1 on chromosome: 3 position
5137846 to 5151854

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00978770(coding)
ATGAGTTTATTTGTATATTTGATAACTCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNAGTAAATAAAAATGAATACTATTTATTTTACTAAATATTTACATACAACA
TTGTTTATTTCATTCATTTTATTAAATATTTATTACATTCAGTTCGAAGGTTAGTAGCTA
GAGATATATATATATATATTTGCATGCATTTTGTATCATATAAGATATTAAAATATATAT
ATAATACATTAATTAAATCATTTATATATTAAATTAAAAAGACAAGAAAAAGGAGAACAA
GACAAGGAAAATTATATAAAATAATAAGCTAAGAAAATAAATTTTTTGGTAGAAAACAAA
AAAAGGTTAGAAATGTCATAATTTATTTTAAAAGGCGAGGCGCTTGTTCAAAAGATAAAG
TAAAAGACTGGCCTTTCTGATTTTAAGAAAGAATTGAGAGATGAAATTCAGAGTTTTTAT
GACACTTTCATCATCCCATATCAAACAGATTAAAATTCAAACCCTCAAATTAATTAATAT
AACTATGAGTCTATAATGAAGTAGCTGTATTAGGAATATATATAAATTCTAAAATACACT
CAAATGACATTTAATGATAACGAAATACAACAAATGAGACACTTTATATTAGATAAGATT
GTAGAGGACTCAAAAATTCCAGTCCAACCAATTAATACAGAGCTAATTGACTCTCTAAAT
AATATCATTTAAGACGATAATAACAAAAATAGCTTACTAGGAATCAAAGCACTTTTTTAA
ATGATTAAATGCCAGTCAGACAAATTACGCTAAGGAATAAATTAAAGGCATGAAGTATCG
CCTCTCTCTTTTGTTTAAAAGGAGAATCTAGATTTAATTCACTGCATTATTAACTTTTTC
ATAAATCACAAAATGCTTAATTTTCAAAATTTGAAAAACCTCTTTCAACAATAAAAGGAT
AAACAATAATATTCGAATTATCTCAAGGATTAAACTATCCAAAAACAAATAAATTTATAG
CAACAAAATGAAATGCCTCTGATTGAAAACAAGTACGATCTAAGAATATATGAGGAAATG
ACAGCAACGGTATCTGTTATAATAATCTTCTTAGGAGAAGCCCAAAAGCTAGAACAAATT
TAAAAGCAAGTTGAAATATTGTAAAAAATAAGGTAAATTATCGAAACTATCAAAAGGTAT
TTAAAAGCAGGGGTTGATGCAATATATAATACAAACTTCGAATACACACAGAGCGAATTT
AACAGAAAATTTCATGAAGATTTAGGTACAGTACACAAAAAAATGATACTGTATACTTCA
TAAGTTTACAACAGCATCTAATGGTAAATTGATTAAAATACTAACTCTTCTATTTTGATC
TCAGAGTTACTGAGGGTTACATCAAGTTATGTTGCTAAATTTCCAGATGAGTACATTGAT
ACTAAGATTTAGCTATACAAGGTTTACTCTAAAGTTTTAATTGCTTAGTAAAATTTTAAT
GACAACGATTTAAACTAATATGCTTTAAATTATCATGAAGTATTTATGATGGACAGGTTA
GTCAGCAATCACAGCAAAATAGAAATCTTGACACTATACATATTAATTATTTAAACTATT
TTTTCAATTGATTTCAATTAGCAAAACTAGCGTGGCTTACCCATGAGAAATCACTAGACC
TCTAAAATTAGTTAACTTAATGATTAAAGAGTTCAAGAATAAGTTAAAGTTATAATCGAA
AATTTGATTTCTACTTTATATGACAATAATCTGAACTTAGAATTATAAATTAAAATTGTA
GACACATTAAATAGCTTAATTAATAGATACATAACATAGGACAATGAATATTTTAAAAGA
CAAGGTATTAATCACGATTAGCTTTAAAATAAAATCAAATACTTAGAAGAAATCCTCAAA
TTTGTATCAACCAAATATAAAGATTTAAATTTTGTATTAATTTCCATCTAAAATTTTCTT
AAAAAATAATTTATTAAATCTTAACAATAACCAAAACAACCGATTATTCTACCTAATTAG
TCTATTACTTAACCAATTTCGGCTCCAAATCCTAACTTATTAAACATAAACTAGCCAGTT
TAACAATAAAGACTACAATAGCCTCTTAACTAGCCACCAGGAGCTGCATAATAGTTAGCT
ATGCGTACTCCTTAGCCAAGGGCTATGCCAAATGGACCCTCAAATTCCTAAGCAGTAATT
TAAAAAAAGCCTGCTTAATAATAACAAAATACAAGTGTCGAAGATGAGTTATCAATACAG
AAGAAATACATAGAATGGATTCAAAAGAAGAAAAATAATGTTAGTCTTAGCACTTTTCCT
AAAATGCAAAGAGTGAAACAAGATGACTCAACAGAGTTAGAGAAGATATAGTAGGAAATA
TTAGAAAATGAGGATTATTACAATTTTTAGGTGGATAACATTATTAAGTTAAATGCGAGA
GAAGAAATTTAAGCAGAGTTTGAAGGAGAATTTTTAAAATTTCATGGAATAGAAATTAAA
GCAGAGAATTTATAATACTATTTTACATAGATGACCCTTTTTATTAGAAATTTTATTGGT
TTTCAATATAAAATTCAATTGAGTTTATTTGAAAAGAATACAGAGTATAAAAAGTAATTC
CAACCAAATGAGTTAAGCAAGGCTTATAAATAGTATAACTTGAACTAAAACTAACTTAAC
ATACTAAGAAAAATTTTCAAAAACGGTATAGAACTTTTAACTAATTTTCACTAAATGGCA
CATGTTGAGGCAAAATTCATTGATAGCTCCTGCATTTAAAGATTTATTAAAATTTTTGCA
ATGATTGAACACGAGTGCCATTTCAAAGATATAATCGAGCCTAATTTCAAGTTAATACTT
AAGTTATTAATAAAAACCTATCAGGATACTGATAAAAGTTAATGTTAATGCTATAGATAG
ATTATTGATGGGGCATTTTAAGAAAGCAGTAATGCTCAACCTGCTAATCCTCCAAATTAT
TTCCCTACAGCTAGTTTTTTTAATCATATTCTTTTAAAAAATTTTTTCCTTATTATAGAG
CAGTCCAACGAAACTATCGATCCTTTTAATGAGTTTTATGGACTTTATAAAAATAAATTC
TTTGAAACAATTTAGTCTTTAATGAAATAAGTATTTATCGGAATCATATCACAATATGAC
AATGACTCGTACAAACAAACTATTAAAAAAAGCATTCTATTTTTATTTAAAAAGATTCAC
ACTTCTCCTTATCCTTTAGAATATCTTAAAATCTTGAAATGGTTTTCTTATGAGCTGAAT
GAATAAATCATTAAAAATCCAAATAAGGAAAGTTAAATAAAAAATGAAATATATTCAATA
TGCTAATCACCAGATAAAATGGCAGATGACAAGCATGTTGATCTTCTAAATTAAGAAATT
ATAAATCTAGAAAAGTCATTAACTGAAAATAAGGATTTGACTGAAGACAAAAAGTCTTAA
ATCAAAGAAAAGCTCAAAATTAGTAAAGATAAATGCAAATATTTTGAAGGTATAAACATA
TTAGACAATATTATTTAGCTATTAGAATTAAATAGTTCTAAATTCTAGGCTTAAATTGCT
AAAATATTCCTCTGCTTACCTAATTTATATAATCAAAACCTTGACTTATAACGTAAGAAA
CAGGTTGCTAAAATTCTTTTGATTTGCATCACAATCAATGAAAGAAACTTTGCTACTTAA
GCCCTCCAAAATTTGGAAAATATAATTTAAAAGTTAACTAGGGAGGAATTAGAAGTTGCT
TTAGAAGATATCAAAGAAGAACTAATTGATAGATTATATTAAATAGCAAGTGAAAATAGA
CCAATAGATTTTACATTGAAAAATGAAGAACTTGAAAAATAGATTAAATCAAGCAGACAA
AATTAGTAGCAAAATATTAATCTGAAATTTACAGATAATTCAAAGATAGCTTTTAAATTG
CTTTCAAAATTGTCATATCTTACAAAATAACATAAAATACACACTTTTATTTTCGAAAAC
GAGTCTGCGCCTGAAGCTTAAGAAAAAATTTACTTAGAATTCGATGTCCTATAAAATAAC
ACAAATGGATAACCTTAAAAAACTATTTTTAAGCTAGATGTTAAGCAATCTATTGAGCAC
GCAATTAGTTTATTTAATAGAATTATTAATAATTTTAATAACTAACCTATGAAAAGTAAT
GTTATTGATATATCATTTGCTTTGATCAAATTTTCTGTCGTTAAATATTTCTGCAGAAGT
GAAAATTTAGACATAAAATGGCTTTATGAGAACGAAAATGGTGTTAAGTTTTAGGAAAAG
TATGCTCAAAAGAGCTAGCAAGATTAGCAAGAATAACAATAACAAGGTAAGTAAATTGAA
GAAGCTATGTAAGAAGAGTTTGAAGTTAAAAAAAAGATTCTAAGAGAATTTAATTTTGAA
TAACATGAACAAGAAGAAGCAGAACAAATTTTAGATAATAAATTTAATTGCTTTTTTGGA
ACTAGTTCCTCTCCCAGTTAAAATTCTTCTAATTTACTCATTATGAAACTACTCAAAGTA
CTGATGGACCTGACTTCTATTGATTAAAAAGTTGAAAGGGATCAAGGTTTACTTTTGAAG
ATTAGAAAAGAAAGTGAGAGAATTTTAAGTATCATCTCAAAGGTTATCTGCCAGAATATT
ATTGATTTAGTCTTGCTCTAATTAGGTTAAAACACTAACTCTAATTAGCTTTACTTCAAA
AATCTTTTTGACAACAAAAATAGTCCTTATCATGTGTTTATAGCTACAATAGTTAAATCT
CTTAAGAACTCAAATTTCATGGAGAGAAGAAACAATTAAAAAGCACAAATTTGCAATGAA
AAACAATTTTTATGGAATGAGCTATTAATTAAGAATATTTACAAAAACCTTCAAACTGAT
GGAGTTAAGCAAATAGTTTAACAGATACAATAACAACCAAACTCTAATTAAATGGTGCTA
GAACCTTCTCCAAAAATGGCTAATAACGAAAGCGAGTAAGCTAAATAAGTCATAGATATA
GTAGTAGGAGAATTGGAGAATTTTATTATCTATATGCTCACTAAAGAAATTGGAAATAGC
AATGACAGCTTTATCCAAACCTCTAATAGCAGATAACTATTTTTCCCAAGCTGTGAAGCA
AGCTAACAATAATCTACCAGTTAGATGATTGGTAGTAGTATAATCTCATCTCACAACTTT
GAAAGTCCCTCTGATAGTAGAATGTTTGACAACAACAATAATTCCTTGAACAAGCGCTAC
TGTTTAGTAGAATGTCTGAATGAAGTGATGAGTATTTTCAAACAAAAAATAATAGGATAG
CATATTTAAAATATTTTAGAATGTGCATACATAATCTCAAATAATCTACCTGAAGTAGTC
AATTTGCAATCTATGTAGGATTTCTGTCAACTTTTGATTAAGAAGATTTTACAATACATA
AAAAAATAGAAAGAACAATATAATATAAATAGTCCTCAATTTAGGAGGATATTATAGACA
TTTGTGAGCAATCTAACAACATGCAAGCCTCTTTCTCATTTATACTCAAGGAACGCTCTC
AATTCAATTGCTAAAATTCATAACACAAATGTAATATCAATTTTGTACCTTTCACAAAAT
GGAAATACGAACGAAGATGTGAAATTCTGTGATTCTTTTGACTAGCTGATTGCTTAGGCT
AAAAAAGAAGATGATTTGGCTGATAATTTAGCAAGCATTTAGTAATTAGAATAAATGCCC
TCTAAGTACGATTATCAAACTTTAGTTAAAAACCACAGAAATTTGTACATATCAGAATTA
TTAATCTAAATCTAGACAGCTATCTAAACTTTTTAACATGATTATTTGATGAACAGTAAT
TTGTACTACACTCAGAATTCTTAAATAAACAAAAAGCTCTTGTGTATTTTCAATTGCTAC
AAGAGTTTAGAGTATCTGCTTGCCTGTGAAAACTGTCTACCTTTTAAGCTGATAGGTATT
TTAAGGATACAAGAAACTCCTTAAGATTTAAATTTATCAAATTAACAGCCTAAACTATCC
TTTTATTTCAAATTTGATGAAAGCTTTTAAAAAATCATTTAAATTTCTCAAAAAATAATT
GATAAAAATAATAAAGAAATGAAAACATCAAGGATAATACTATCAAATCCCTAAGAAGCA
GCTATGCCAAATTAGATTCCTCCTCTTATAAACCAGGGTTAACCTCTACCTCCTCAAGGA
ATCAACTCGTCTTAAAACTTGCTTCAATAACCTCATCTAGCACCTCCTATTAATTAACCT
CACTAAGATTTAAATTAGTCTATGAACAAAAGCATTCCAGGCAGAGGTTCTGTTGGAGAT
AATATGTTTGTAGGTGGACCTAACACACCAAACCCAAGAAACTAAAATGGACCGATGATG
CCGCCACCTCATCCTAATGTTTTACCAAATCACCCACCAAATATGAACCCTAGTAATTAA
AATAGCAGAATAATTAATTAATATGCTAACAATCCTTAAGCTATACAGTAGCCAAATCAA
CCTTATCCAGCCAACGCTCCTCCTCCTGCCAGACCAAACAATTAATATCAAGCCAATCCA
AATATGCCTCCTCCTAACCCAAATAATCCAAATTACCCTCCTCCGGGACCTGGCTATTAG
TATAATAACATGAACAATTAGCCTAATAGACCTATGCCACCAAATCCAAATATAAACAAT
ATGCAATAAAGACCAATGAATCCTCCTCCTCCTCCATAAAATTAGCAACAAGCATAGCCT
AAAAGTTAAAATTCTTTTATAAATTAATGCCAACTATTTTATGAAGATGAGCTTGGATTG
AATATTGAGGATCTTAACTTCAACATAAAAAATTGGGCTAAGGTTTTGTCTTCTATTATT
TTGATATTAAAGTAGATAAACTTATCGATTCCAACAAAATACTTTAACTCATTAATCGAT
AAAGAAGAAAAGAAAATAATTGAACAAAGCAATCCAAACTATATCAGAATGCCTCCTGAA
TTAAGAGCAAAAACATTTGAAAAAATAGAAGAAATAAATTATTTGAATTTGAATAAATTA
TATGAAATGATGCCAAGGATAGAAAAGACTATTCACTCTACAGTCTAGGAAAGTATAACC
GAAATTAATAAAAAAAATGGTAATAATAATAAAGTTGCGCTGGAAGAAGAAAAGCTGAAG
GTTATTTTAAGGCCTATGCTCGTCTGTTTGCAATCCCCATTCAACAGGTTCACTCCTTAG
TTTTTATTAATCTTTAAGAAGTTGCTTAAAATGCTAGTAAACTGCTTTAATGGTAGGCTC
ATTATTCTCCTGTTAAAATAGCTAGACGAAATTATCAAGGATACAAGTAATCCATTAAAT
GAATAGAGTTTTTCAAATTATAAAATAAAGAATGTCTCAGGTGTATTATCTTTATTCTAG
CACTTAAAGAATCCATTCTACTAGCAGAAAGGCAGTAGAGAAGCAGTAAGTAGTAAAGAG
CAGATCAAATAAATTCTTAATTAAACTATAGATATATAAAAGAACTATAGTATAAGATAT
GGTTGGCATTATGTCGAACAAAAGACTTTGAATCCAATTTCAAAATTGCTTAATGTATAA
ACTGAATTTGTTACTGAAATTTTGATGAAAGACAAAAAGATTATTTAAAATCCTTAACAG
CCAAATGATCCTCTAAATTCTCTAAGCGAGTAGACTTTAGAATTTATCTACAAAGTAATC
AAGATGGACTAGAGCTTTGAATTGAGAGAAGCACTTACTCGTGAATTCTAAGATTAAGAT
TTCTTTATGAGATTTTGGGATCCTTAGAGAAATTTGCAGCTTTAACTTAAGATTATTTAC
TTGCTAGCCAAAAAAAGCTCGAGAGTATTTAAGTAATAAAAGATAGATGGAATTAAGTTT
TTAATTGATGAGAGTAAAAAGATATAAAATATCAATTTTATGAATTACAAGAATTACATC
CTCTTTATGAAATTGTTTATTTTATACTTCTAGAGAAAGAAAGATATTAACATATTCACT
TACATCGCAAGTAATTATAGTGAAAAATACCCTTGCCCTCACTTCTTAAAGAGATTCTTT
GAAGAACAAGTCTCTGCGCTCTTATCTGTTGAGTAAAAAAAAAGGTTATTGCAGAATACA
TTAACTAACATGAGTACAAACATGGATGTTTAAAACATAAGAATTATGTTAAAGCTAATT
ATAAAACCAATAATAAAAAGTTTGACCAAAGAGCAGATTATTTAAATTATTACTCAACAC
TAAAATTAAATGTAGGGCAGGCCAGGATAATAATCGATGATTGATTTTTTATTTGAAGCC
TAAAAGAGATTCGATGAAAGATTTAAGAGATTCTAATCTGATCTTTAAAATATTCCCCGT
TTATAATAACAGAGACAAGCCGCTATTTAGCATTAATAGCCAGGATCATTACAAATGGTC
CATAAGTTATAACAGGATATTAAAAGAATTTAAAAAAATAATGATAGATTTTCAAAGGAG
CTGCTATAATTAGAGCTATGTAGAATAACATTTTTATTTGGAAAAGAATTAAAATAAGAT
TACCTCAAGAGATTTTAGAATCACATTTTTTAAATTATATCAGCAAATTTAGATTAGACT
GAGAATCCAGTCATTAAGCAGCTTTATTATTAACTTTAAATAAAGATTATTAGATTACAA
AATTTATAGGGTGATCTTCAACGTAAAAAGCAACTTCTAAGCAACATATTCAAAGCATAC
AATTTTAATTCACAAGAAACAACCAAAAACCACACTCTTTAGCAATTAATTATTAATAAC
GTAAATTACTTCATTAAAAATATAAGCAATACCAAGTAAATTAGACAAGAAAACTAAAGG
TAACTTTAATAATAGCCACAATCATAGCTTTAGGCAACAGCAGCAATAGCAGCTTAAAAT
CAATAGTAGTAACTTAATGTTCAAAATAAAATAGATTAACAAAGCCAACAAGGAAATTAA
AATAATCAAATACAAACTAACTAAGCTATTCCAGCTCTCAATAATAACCTACTAAGTAAT
TTAGAATTAAAAACTAATTATGAAATTGTGAGAGAATTCTTAGATATGGATAAAGATAAA
ATAATTTTTAATGCTATTATCCAATAAAATGAATACTTCTATGACATTAGAGAAACAGTG
GCAATTGACATTTTTAAAGAAATAAAAGAATAATACCTCTTTTACAAAAAGAAGGCAGAA
AATGAGAAATAAAAGATTAAAAAATTCTAGTAAACTTTGGATGATGAGAATGGAGGTATC
ATGCTTTTATGGGAGCAACAACACGATTAAAAGAATAATGAACGTTCTATATTTTTGATA
AACTTAATAAATACATATGTTTATTGGAAATTTAGAGAAATAAAAGAGGAGTCTAAAAAC
AAAGAAAATGCTAACACCTAAAAGATGGAAGTATGTAAAAATTCAGAAAGAAAGTTCTCT
AAGCACGCTATTCATTTACTAATTCACTTCATCTTTGACTTATCAGAGGAAAGAATCGAA
AGTTATCAGATCCTTCTCAAAAAATGTTTAATTTTATGGAATAACTCGAAGATAGACTAT
AAAATGATTAAATATAAATACATTTTTAATATGCTTAAAATGGACAATGAAATTACTTAG
AATTAGTAAAAGATTTCTTACGCAAGACCTCACGTTAACAAATATTGTCTTTTTGTTCTA
AATATACTAAATATCTGTCTTGAATGCTCATCTTATACAGAAACTAACTATAATTATCAG
ATCAAAGATTTCCTCAAAATTCTTAATTGGTCAACTCTATATGTGCTTAATAAGTAAAAA
TAAAGAAATAAAAATCCTTCAATTTCAGTTCCTAATAGCGCAAATCCTCAACAAAACCCA
TAGCAATAACCAAACAACAATACTACTACTAATAATAATCTACCAGGCACAACTCCTCAA
GCTCAAGGGTCAAGTCAAAATTAAAATTCAGTTACACCAGATGGCGCCGGATAAGGATAA
AAAAATATGATGTAAAAAAATGTAATGCCTAACAACCAAATAAAAAAATAAGAGAAAGCA
ATAATCAAGGAAAGGAAAGAATATTTTAGTTTGATGAATACAAGCGAATTAGAACCATAT
ATGGTGATTATGGTAGCTAATATTTTGTATTCACTTTTGAATGTCTATGAAGAAGACCCA
CACGACAAATAAATTAAAGAATTCAAAGCTAATCTCATTAATTAAATTAAGATAAATATA
GAAACACACCATTTTTAGATTGATGGATAAGAATTGCAATCCTAAGAAGTTTAACCTCCT
ATGTCAGTAGACTTGATTGTCAAGTTGATAATTTACCAAGCTAATTTAAATATAGAAGAT
CTGTATATCATCAGATTAAATTAAATACTTATGATTTTGGAAAATCAAAATAAGAAGCAT
AAAACAAAAGAAGATGATAAAATTCAGTATGATAAATTATTTTATGAAAACTTCTTCTGT
TAAAAATATGCAAATTATATTCCTCATAATAGCTGCTTCTATTTCGAAACAAGTAAATTA
AGTGCCTAAAATTTGCTTAGTAAATTTTATGAAGAGAAAATTGAAATAGAATAATAACAA
GGAAATGATGATTTCTTTTATTAAGAAGCTACCTAGTAGTTATAAAATAGGAAAAATAGA
TATGTTTAATTACTTAAAAGAGAAGCCGGATTTGAGACTATGTAATGGGAAATCGATTAA
CACCTCAAGTATAGTATTAATTTGTTCAGAGATCATCAAGAATTCTTTGAATTCCCTTTT
ATTAGATAATATAGTAGCAACCTAAGCAACTTTTTAAAATATTCTTAAGCTCAAAATTTA
CTAGGATTGATGTATATTAGCTTGTGTCTTCTACCAGCTATCAAGGAAAAGAATTAAGAT
TCCTTGCTTTAAAATATAAAAAGAATTCTAAAAGTACTTTTTAATGTAGTCGATGAAGGC
GTTCACTACTAACTAAGAATAGAAGCTTTGAATTTGCTTAGAGTATTTTTCTTAGGTAAA
AGCAATTTCCCAAACAGTGAAGTCCCATAGAGATACACAAAGATTGTATAGATTATTGAC
TTGCTATCATTTAAGAGCAGAGATGAAATTATCTAATGGGTATTTGTGTATTAAGATATA
GAAAAAAAGTATAGGAAATTCCCCAAAAATTACTATTACTGCATTCCAGAAGAAATTGGA
TTTTCGAATACTACAAGAATAGCAGAGGAGAACATTCAATTTTATTTCTTTAAATTCTTA
GTTGATATCTTAAAATTAACTGGAAGTTCATTGAAAAACATCTCTCCTGTAGAACTCAGA
AAATATTTAATTATTTTCTCCAAACTTTAATCCTCAAATAATTTAGAGTATTTATTTGAT
ACGATAGAGCAAACTGAAAATATGAATGAGCTTAACTCGATGTTACTCATTCTTGGGCAA
GCTAAGTATGAAGAGAAACTGTTTGAAGGTAGTAGCAGCAGCAGCAAAGAAATTACTGAG
GAATTGCAAACTCATTTGCAAAAAGACGAAGGTGATACTTCTTACTACGAAAATGATGAT
GTTTATTTGTTTGCATATAAATACCTTCTCTACAAAATGAAAAAAATGTCAACAAATGTC
AAGCTTGTTTTCAAAAACTTCTTTAAGTTCCCTAAGATGGTTATCACTTAATCAGCTAAC
TAATCTAAGAAAATAGCCAAGAATCAACTTTGTGAGGATGTTCAAGACCTTTTAGAAGAA
ATTCATGAATTCGATTAAAAAAGTTAATTACAGTGGGTTCTGGAATGTGTTCAAGACATG
ACTTAAAGCTGCTCTAGAAAAACTACAATCGCAAACGACTTCAAATAAATTTCCTCAATT
GAAGAATTCAGATATATTGTCCTTGCTTAATAAAATGTTTCCAAATATACACCTCTAAAT
ATTCAACTTATTCAACCCTCTTTCATATCATTAATTAAGTTCTTAATCGAGTCAAGCTAG
ACTAGAGCAATGAGAGTGCTTCTTTATTAGTCAATTGAGGAGTACTTACTTTTCTTTTAG
AGCCAGTAATATAATACCTACGGTAACAGAGCATATTCAATTCCTGGTTTCTAGTAAAAT
GAAGATAGAAGAATATCGAAAAACTGGGCGTATGCTCTTTTTAATGTGTTTTTCTTTGAG
TTCAACTAGAAAAACCCATACATAATAAACCCTAATAGAGTTTACCAAATGATAAAAATT
CATCATTGTTGGGATATTGGGTTGATTTATCTAGAAAAAACTGCTGAGATGATGAATGAA
AATTTATTAGAAGCTGATATTCAAGTTTATGAAAAAATATAATAAATTTACTAGGATTTA
GGAGAAACTGATTACATGTATGGAACAATGAATTAGCTTATTAGAAATGATAACCTTAGG
AAGGCTTTGTGTCTTGTCCAACAAAAAGAGTTCTTGCAAGCTCAATAAGCTTTAATAGAA
AATATAGACAAGTTGAATGAAAATGATCAATCACGATGCGATCTTTATTCCTCTCACACT
TAAGACTACGAAACTCTTTACTTTATTTCCACATATAGATAGCTTTTCATAGAGACATAA
AAAAATTTAAATGAATGGGACACACTCTTAAATCTTAGCAAAGTTGAGCAGAATGATCAC
CTACTCTCAGAATCTTCATACTTCAGCTTGAATAAGAATATGAAAGAACTATCTAGAGTT
TTAGATAAGGATTTGCTAATTTTGAAAGAAAGTAAAGAGATACCATGTGAGTACCAAAAC
TTTTATTTCCAGCCATCATTTATGTATCATCATGTAAATATCTTGTAGTTATTTAATAAG
CGTGTATAACTCTTGTAAATTGAGTAAAGTCTTCAAAAAGCAAGTGTATAATTAGCATAT
GAATGGTCTGCGCTTCCAAAAACTATTACAAAAGCTCATTACAATCTAATAACTCAGCTT
TAAGTTATTACAGAATTAGAAGAAGCGAGTAGAGTATATGGTAAATTAAAAACTGATGAG
TAAAGATATTTCTAGTCATCCCTTCCTACTTTTGACTAGATGACTTTATAATGGAGAGAG
AGAATGCCACATAAATATGACTCACTTTTGAACTGGAAAATACTTGTGAATCAAAGAGAG
TTCATTTAAAATACTTTCTTTGATATTATTAAATAGATAATAGATAGAAATATGTAACAG
TAGCCAAATCAAAATTTACAAAAGCATTACAAAGAAAATCTTTTGATGCAGCATATGGAT
TTAGACTATAATAACTATTAATACTTTAAGGTTCTTTAGAATTATGGCATCACAAATATG
AATTTATTGCCTCCCAGAAGAAATGAGATTGTGCCAATTGAAGATACTTATTTAAGGCTA
AAATGCCTGATGAGAAACTCTCTAATTGACAATAGCTCTACTACTGAAGAAAACATATAA
GAAATAAAGAAGATTTTCGGTGAAACTATACAGAAACACATGTAAAGTGAAAGCTAAAAA
CAAATGAACCCAATGAATTTAAAACCCTATTTTGAATAATTGCAGGAGTAAATTAATCTA
AAACTATCTCAAACACTATTCAAAAAAAAAAATTACTTTGAAACAATTCAAAATATAAAA
TCGCTTCTCAATAGACCCTACAATCTTCAAAAGATATGCTATACTTACCTTGAGATTTGC
TTTAGTATTTTGAAATCTGAGAAAAATCACACAGATTACTTCAATAAAATGATAATAAGT
TTAATGGGAGAAGCTTTAAAATATAAACCTTACTACTCAAGAATGTATTTTGTTTTGTTT
TGTTAACCTGAATTTATTGGTACAAACTTCGATTAGATAGCCTAAATTTAAGATGCTAGG
AGTTTGTCTAATTAATTAATTTTATGGTTGCCAAAGATTTTATATATGTATTAAAAATAT
AAAGAGTAAAAGGAAAGTAATAATATTGCATAGGCATATATAAAACTATTAGAACTTCTT
AGACAATATGATTAATATTTATTTTTAACACTAAGATCATATTTACCATAAAAATAAGAA
AAGAATGCATTATAATAAATTTATTTGCAAATGAGAGAAAGCATCTCAGGCAGAAAAATA
GAATCTCTTTTCAAGACTCTAAATAGCCCATTGACAGAAGATCCAAAAAAGCTATTCCTT
ACTTTAGAAATGAGATACTAAGAGTTGGATTAAATTTTAGAGCTAATTTAAAATCTTCCT
AGCTTAGAAGTTTATAAAGATATGCTTGAAAAATAGTTAATTTATTAATTAGAGAGCTCA
ACTCAAAACTTACATAAAATTATTCCTGAATTTGTTAAAATTTAAAGTGTTTATTAATTC
ATTAATTCTGAATCTCCTCCAAGCAAAGTTATAGATTTTATACGCACTAAGCTTTACGCA
GGAATAATATAATTTTATAATAAAAATAAGAATTTATTTAATCTAGAATATTCTGTTAAA
AGCCTTCTGCAATTTTAGTTAGACTCATAAGATATTGAGATTCCTGGCTAGTACGTAATT
AATAATCCCCGAATTTTTAGAGAGTTTGCTCCTAAAAGTCACACATTTATGTCTTCTTTG
AATAAAGAAGTAGAGCTTTATCCTTCTTACCGCAAATTTGTTAAAAGGATATTCATAAAT
GCAACCAACTGCAAACAATATGCGTATGAATTTGATTACGATTACTAACATGTGTATAAA
AACGGTGTGTACTATCAGCCTTGCTCTGAAGAATTAAATGCTCATAGATAGCTATAAATA
GGAATTTTATAGCAATGTTTAAATAGCTAGTTCTTTAAAAACAGAGAAACAAACACCAGA
AATCTTAAATTATCTTAGCGTGTGAGACTTCCTTTGAATAGTTTAAATCAGTCTTAAATA
TTATCTTTGAAAGCAAGTTCAAAAACTTTATATTCAATGTAAACTGTACACGATTGGTAT
TTAACCTAATATTGCTCTAAAAGTGATAGCAAATACATTGATAATTTTAACACACACTTG
GATATATTTAACTTCACAAACACAAATGATATTAATAAAAGCATGAAGGATTTAGTTAAA
GGAAATGCCCTTTGTCAGTTCATTCTATCAAAATGCAATACCTATTAAGAATATATAGAT
TTCCGCCAAGAATTTTCATACAATTATGCAGCTGCTTCTTTCTGCAATTACATACTAGGA
GAAAGCGTAAGTCTATAAGATATCTACTTTGATTACAATACAGGAGAAGTCTTTATAGAC
ACTAAAAATCTGGAGATTAGAAATATATAAAATAAGGGCAATTAGGTCATATACAAGAAT
CATCACTCCATTCGTATTTCTAATTCTATTGCTAAATTCATAGGATAAATAGGTATTTCA
GGTATTATGTGCTCATCTTTTATAGCGATGGCTAAAGCAATTACAACCAAAGAGTTCCCA
TTCATTCCTGCTATGTAATCAGTCATAGAGGACTTGTTATCTTTAAATAATATTCCAGGA
GATAAGTAAATAATATTTGATCAAATAATTTAGAAAATCTTATGGATCTACAGCTAAGAG
TACTAAACAAATAATTTCTCTAAAAATGAAATTTGCACTCGCGTTTACACTATATTTGAC
ACTATTCAAGAGAATTAGTTAAATGTTTATAATCCCATCTCTTATAAATACTGGTTTTGA


>TTHERM_00978770(protein)
MSLFVYLITLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIKMNTIYFTKYLHTT
LFISFILLNIYYIQFEGQQLEIYIYIFACILYHIRYQNIYIIHQLNHLYIKLKRQEKGEQ
DKENYIKQQAKKINFLVENKKRLEMSQFILKGEALVQKIKQKTGLSDFKKELRDEIQSFY
DTFIIPYQTDQNSNPQINQYNYESIMKQLYQEYIQILKYTQMTFNDNEIQQMRHFILDKI
VEDSKIPVQPINTELIDSLNNIIQDDNNKNSLLGIKALFQMIKCQSDKLRQGINQRHEVS
PLSFVQKENLDLIHCIINFFINHKMLNFQNLKNLFQQQKDKQQYSNYLKDQTIQKQINLQ
QQNEMPLIENKYDLRIYEEMTATVSVIIIFLGEAQKLEQIQKQVEILQKIRQIIETIKRY
LKAGVDAIYNTNFEYTQSEFNRKFHEDLGTVHKKMILYTSQVYNSIQWQIDQNTNSSILI
SELLRVTSSYVAKFPDEYIDTKIQLYKVYSKVLIAQQNFNDNDLNQYALNYHEVFMMDRL
VSNHSKIEILTLYILIIQTIFSIDFNQQNQRGLPMRNHQTSKISQLNDQRVQEQVKVIIE
NLISTLYDNNLNLELQIKIVDTLNSLINRYITQDNEYFKRQGINHDQLQNKIKYLEEILK
FVSTKYKDLNFVLISIQNFLKKQFIKSQQQPKQPIILPNQSITQPISAPNPNLLNINQPV
QQQRLQQPLNQPPGAAQQLAMRTPQPRAMPNGPSNSQAVIQKKPAQQQQNTSVEDELSIQ
KKYIEWIQKKKNNVSLSTFPKMQRVKQDDSTELEKIQQEILENEDYYNFQVDNIIKLNAR
EEIQAEFEGEFLKFHGIEIKAENLQYYFTQMTLFIRNFIGFQYKIQLSLFEKNTEYKKQF
QPNELSKAYKQYNLNQNQLNILRKIFKNGIELLTNFHQMAHVEAKFIDSSCIQRFIKIFA
MIEHECHFKDIIEPNFKLILKLLIKTYQDTDKSQCQCYRQIIDGAFQESSNAQPANPPNY
FPTASFFNHILLKNFFLIIEQSNETIDPFNEFYGLYKNKFFETIQSLMKQVFIGIISQYD
NDSYKQTIKKSILFLFKKIHTSPYPLEYLKILKWFSYELNEQIIKNPNKESQIKNEIYSI
CQSPDKMADDKHVDLLNQEIINLEKSLTENKDLTEDKKSQIKEKLKISKDKCKYFEGINI
LDNIIQLLELNSSKFQAQIAKIFLCLPNLYNQNLDLQRKKQVAKILLICITINERNFATQ
ALQNLENIIQKLTREELEVALEDIKEELIDRLYQIASENRPIDFTLKNEELEKQIKSSRQ
NQQQNINLKFTDNSKIAFKLLSKLSYLTKQHKIHTFIFENESAPEAQEKIYLEFDVLQNN
TNGQPQKTIFKLDVKQSIEHAISLFNRIINNFNNQPMKSNVIDISFALIKFSVVKYFCRS
ENLDIKWLYENENGVKFQEKYAQKSQQDQQEQQQQGKQIEEAMQEEFEVKKKILREFNFE
QHEQEEAEQILDNKFNCFFGTSSSPSQNSSNLLIMKLLKVLMDLTSIDQKVERDQGLLLK
IRKESERILSIISKVICQNIIDLVLLQLGQNTNSNQLYFKNLFDNKNSPYHVFIATIVKS
LKNSNFMERRNNQKAQICNEKQFLWNELLIKNIYKNLQTDGVKQIVQQIQQQPNSNQMVL
EPSPKMANNESEQAKQVIDIVVGELENFIIYMLTKEIGNSNDSFIQTSNSRQLFFPSCEA
SQQQSTSQMIGSSIISSHNFESPSDSRMFDNNNNSLNKRYCLVECLNEVMSIFKQKIIGQ
HIQNILECAYIISNNLPEVVNLQSMQDFCQLLIKKILQYIKKQKEQYNINSPQFRRILQT
FVSNLTTCKPLSHLYSRNALNSIAKIHNTNVISILYLSQNGNTNEDVKFCDSFDQLIAQA
KKEDDLADNLASIQQLEQMPSKYDYQTLVKNHRNLYISELLIQIQTAIQTFQHDYLMNSN
LYYTQNSQINKKLLCIFNCYKSLEYLLACENCLPFKLIGILRIQETPQDLNLSNQQPKLS
FYFKFDESFQKIIQISQKIIDKNNKEMKTSRIILSNPQEAAMPNQIPPLINQGQPLPPQG
INSSQNLLQQPHLAPPINQPHQDLNQSMNKSIPGRGSVGDNMFVGGPNTPNPRNQNGPMM
PPPHPNVLPNHPPNMNPSNQNSRIINQYANNPQAIQQPNQPYPANAPPPARPNNQYQANP
NMPPPNPNNPNYPPPGPGYQYNNMNNQPNRPMPPNPNINNMQQRPMNPPPPPQNQQQAQP
KSQNSFINQCQLFYEDELGLNIEDLNFNIKNWAKVLSSIILILKQINLSIPTKYFNSLID
KEEKKIIEQSNPNYIRMPPELRAKTFEKIEEINYLNLNKLYEMMPRIEKTIHSTVQESIT
EINKKNGNNNKVALEEEKLKVILRPMLVCLQSPFNRFTPQFLLIFKKLLKMLVNCFNGRL
IILLLKQLDEIIKDTSNPLNEQSFSNYKIKNVSGVLSLFQHLKNPFYQQKGSREAVSSKE
QIKQILNQTIDIQKNYSIRYGWHYVEQKTLNPISKLLNVQTEFVTEILMKDKKIIQNPQQ
PNDPLNSLSEQTLEFIYKVIKMDQSFELREALTREFQDQDFFMRFWDPQRNLQLQLKIIY
LLAKKSSRVFKQQKIDGIKFLIDESKKIQNINFMNYKNYILFMKLFILYFQRKKDINIFT
YIASNYSEKYPCPHFLKRFFEEQVSALLSVEQKKRLLQNTLTNMSTNMDVQNIRIMLKLI
IKPIIKSLTKEQIIQIITQHQNQMQGRPGQQSMIDFLFEAQKRFDERFKRFQSDLQNIPR
LQQQRQAAIQHQQPGSLQMVHKLQQDIKRIQKNNDRFSKELLQLELCRITFLFGKELKQD
YLKRFQNHIFQIISANLDQTENPVIKQLYYQLQIKIIRLQNLQGDLQRKKQLLSNIFKAY
NFNSQETTKNHTLQQLIINNVNYFIKNISNTKQIRQENQRQLQQQPQSQLQATAAIAAQN
QQQQLNVQNKIDQQSQQGNQNNQIQTNQAIPALNNNLLSNLELKTNYEIVREFLDMDKDK
IIFNAIIQQNEYFYDIRETVAIDIFKEIKEQYLFYKKKAENEKQKIKKFQQTLDDENGGI
MLLWEQQHDQKNNERSIFLINLINTYVYWKFREIKEESKNKENANTQKMEVCKNSERKFS
KHAIHLLIHFIFDLSEERIESYQILLKKCLILWNNSKIDYKMIKYKYIFNMLKMDNEITQ
NQQKISYARPHVNKYCLFVLNILNICLECSSYTETNYNYQIKDFLKILNWSTLYVLNKQK
QRNKNPSISVPNSANPQQNPQQQPNNNTTTNNNLPGTTPQAQGSSQNQNSVTPDGAGQGQ
KNMMQKNVMPNNQIKKQEKAIIKERKEYFSLMNTSELEPYMVIMVANILYSLLNVYEEDP
HDKQIKEFKANLINQIKINIETHHFQIDGQELQSQEVQPPMSVDLIVKLIIYQANLNIED
LYIIRLNQILMILENQNKKHKTKEDDKIQYDKLFYENFFCQKYANYIPHNSCFYFETSKL
SAQNLLSKFYEEKIEIEQQQGNDDFFYQEATQQLQNRKNRYVQLLKREAGFETMQWEIDQ
HLKYSINLFRDHQEFFEFPFIRQYSSNLSNFLKYSQAQNLLGLMYISLCLLPAIKEKNQD
SLLQNIKRILKVLFNVVDEGVHYQLRIEALNLLRVFFLGKSNFPNSEVPQRYTKIVQIID
LLSFKSRDEIIQWVFVYQDIEKKYRKFPKNYYYCIPEEIGFSNTTRIAEENIQFYFFKFL
VDILKLTGSSLKNISPVELRKYLIIFSKLQSSNNLEYLFDTIEQTENMNELNSMLLILGQ
AKYEEKLFEGSSSSSKEITEELQTHLQKDEGDTSYYENDDVYLFAYKYLLYKMKKMSTNV
KLVFKNFFKFPKMVITQSANQSKKIAKNQLCEDVQDLLEEIHEFDQKSQLQWVLECVQDM
TQSCSRKTTIANDFKQISSIEEFRYIVLAQQNVSKYTPLNIQLIQPSFISLIKFLIESSQ
TRAMRVLLYQSIEEYLLFFQSQQYNTYGNRAYSIPGFQQNEDRRISKNWAYALFNVFFFE
FNQKNPYIINPNRVYQMIKIHHCWDIGLIYLEKTAEMMNENLLEADIQVYEKIQQIYQDL
GETDYMYGTMNQLIRNDNLRKALCLVQQKEFLQAQQALIENIDKLNENDQSRCDLYSSHT
QDYETLYFISTYRQLFIETQKNLNEWDTLLNLSKVEQNDHLLSESSYFSLNKNMKELSRV
LDKDLLILKESKEIPCEYQNFYFQPSFMYHHVNILQLFNKRVQLLQIEQSLQKASVQLAY
EWSALPKTITKAHYNLITQLQVITELEEASRVYGKLKTDEQRYFQSSLPTFDQMTLQWRE
RMPHKYDSLLNWKILVNQREFIQNTFFDIIKQIIDRNMQQQPNQNLQKHYKENLLMQHMD
LDYNNYQYFKVLQNYGITNMNLLPPRRNEIVPIEDTYLRLKCLMRNSLIDNSSTTEENIQ
EIKKIFGETIQKHMQSESQKQMNPMNLKPYFEQLQEQINLKLSQTLFKKKNYFETIQNIK
SLLNRPYNLQKICYTYLEICFSILKSEKNHTDYFNKMIISLMGEALKYKPYYSRMYFVLF
CQPEFIGTNFDQIAQIQDARSLSNQLILWLPKILYMYQKYKEQKESNNIAQAYIKLLELL
RQYDQYLFLTLRSYLPQKQEKNALQQIYLQMRESISGRKIESLFKTLNSPLTEDPKKLFL
TLEMRYQELDQILELIQNLPSLEVYKDMLEKQLIYQLESSTQNLHKIIPEFVKIQSVYQF
INSESPPSKVIDFIRTKLYAGIIQFYNKNKNLFNLEYSVKSLLQFQLDSQDIEIPGQYVI
NNPRIFREFAPKSHTFMSSLNKEVELYPSYRKFVKRIFINATNCKQYAYEFDYDYQHVYK
NGVYYQPCSEELNAHRQLQIGILQQCLNSQFFKNRETNTRNLKLSQRVRLPLNSLNQSQI
LSLKASSKTLYSMQTVHDWYLTQYCSKSDSKYIDNFNTHLDIFNFTNTNDINKSMKDLVK
GNALCQFILSKCNTYQEYIDFRQEFSYNYAAASFCNYILGESVSLQDIYFDYNTGEVFID
TKNLEIRNIQNKGNQVIYKNHHSIRISNSIAKFIGQIGISGIMCSSFIAMAKAITTKEFP
FIPAMQSVIEDLLSLNNIPGDKQIIFDQIIQKILWIYSQEYQTNNFSKNEICTRVYTIFD
TIQENQLNVYNPISYKYWF


>TTHERM_00978770(gene)
ATGAGTTTATTTGTATATTTGATAACTCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNAGTAAATAAAAATGAATACTATTTATTTTACTAAATATTTACATACAACA
TTGTTTATTTCATTCATTTTATTAAATATTTATTACATTCAGTTCGAAGGTTAGTAGCTA
GAGATATATATATATATATTTGCATGCATTTTGTATCATATAAGATATTAAAATATATAT
ATAATACATTAATTAAATCATTTATATATTAAATTAAAAAGACAAGAAAAAGGAGAACAA
GACAAGGAAAATTATATAAAATAATAAGCTAAGAAAATAAATTTTTTGGTAGAAAACAAA
AAAAGGTTAGAAATGTCATAATTTATTTTAAAAGGCGAGGCGCTTGTTCAAAAGATAAAG
TAAAAGACTGGCCTTTGTAATACTTTATACATCAAGCATTTTAATTTGAATTTATTTTAT
TTTGTCAATTTTGTGCCTTTGAAATGAATGGAAATCTAAGATATCCTTCCCCCATTTATC
ATAATAATAACAATTTTACAAATCATTTAATTTTTACATTTTTTGACTCCTACTTTGAAG
ATGATCAGTAGGATAAATTACAAGTGCAATAATTATATTTAAAAATACTTTTTATATAAT
AATGTGATTGATAAAAAACATTTTTTGTATTAAATAGCTGATTTTAAGAAAGAATTGAGA
GATGAAATTCAGAGTTTTTATGACACTTTCATCATCCCATATCAAACAGATTAAAATTCA
AACCCTCAAATTAATTAATATAACTATGAGTCTATAATGAAGTAGCTGTATTAGGAATAT
ATATAAATTCTAAAATACACTCAAATGACATTTAATGATAACGAAATACAACAAATGAGA
CACTTTATATTAGATAAGATTGTAGAGGACTCAAAAATTCCAGTCCAACCAATTAATACA
GAGCTAATTGACTCTCTAAATAATATCATTTAAGACGATAATAACAAAAATAGCTTACTA
GGAATCAAAGCACTTTTTTAAATGATTAAATGCCAGTCAGACAAATTACGCTAAGGAATA
AATTAAAGGCATGAAGTATCGCCTCTCTCTTTTGTTTAAAAGGAGAATCTAGATTTAATT
CACTGCATTATTAACTTTTTCATAAATCACAAAATGCTTAATTTTCAAAATTTGAAAAAC
CTCTTTCAACAATAAAAGGATAAACAATAATATTCGAATTATCTCAAGGATTAAACTATC
CAAAAACAAATAAATTTATAGCAACAAAATGAAATGCCTCTGATTGAAAACAAGTACGAT
CTAAGAATATATGAGGAAATGACAGCAACGGTATCTGTTATAATAATCTTCTTAGGAGAA
GCCCAAAAGCTAGAACAAATTTAAAAGCAAGTTGAAATATTGTAAAAAATAAGGTAAATT
ATCGAAACTATCAAAAGGTATTTAAAAGCAGGGGTTGATGCAATATATAATACAAACTTC
GAATACACACAGAGCGAATTTAACAGAAAATTTCATGAAGATTTAGGTACAGTACACAAA
AAAATGATACTGTATACTTCATAAGTTTACAACAGCATCTAATGGTAAATTGATTAAAAT
ACTAACTCTTCTATTTTGATCTCAGAGTTACTGAGGGTTACATCAAGTTATGTTGCTAAA
TTTCCAGATGAGTACATTGATACTAAGATTTAGCTATACAAGGTTTACTCTAAAGTTTTA
ATTGCTTAGTAAAATTTTAATGACAACGATTTAAACTAATATGCTTTAAATTATCATGAA
GTATTTATGATGGACAGGTTAGTCAGCAATCACAGCAAAATAGAAATCTTGACACTATAC
ATATTAATTATTTAAACTATTTTTTCAATTGATTTCAATTAGCAAAACTAGCGTGGCTTA
CCCATGAGAAATCACTAGACCTCTAAAATTAGTTAACTTAATGATTAAAGAGTTCAAGAA
TAAGTTAAAGTTATAATCGAAAATTTGATTTCTACTTTATATGACAATAATCTGAACTTA
GAATTATAAATTAAAATTGTAGACACATTAAATAGCTTAATTAATAGATACATAACATAG
GACAATGAATATTTTAAAAGACAAGGTATTAATCACGATTAGCTTTAAAATAAAATCAAA
TACTTAGAAGAAATCCTCAAATTTGTATCAACCAAATATAAAGATTTAAATTTTGTATTA
ATTTCCATCTAAAATTTTCTTAAAAAATAATTTATTAAATCTTAACAATAACCAAAACAA
CCGATTATTCTACCTAATTAGTCTATTACTTAACCAATTTCGGCTCCAAATCCTAACTTA
TTAAACATAAACTAGCCAGTTTAACAATAAAGACTACAATAGCCTCTTAACTAGCCACCA
GGAGCTGCATAATAGTTAGCTATGCGTACTCCTTAGCCAAGGGCTATGCCAAATGGACCC
TCAAATTCCTAAGCAGTAATTTAAAAAAAGCCTGCTTAATAATAACAAAATACAAGTAAT
ATTTGCTATTTCTTTCTTTCCTTTAATATTAATATAAACTTACTCCTTAAAAATTTATCT
TGATATATTTTTAAAAAGCAAAATTTACTTTATTTTTTTATCAGAAAATTAAATTTAGAA
ATAAAATAAAAAACTAAATATTATTTAGAAAGAAACAAAATTCAATATAAAAGAAGTTCA
AATTAAAATTATTTATTAATTTATAAGAAAAATAGAATTTAATTTCCAAATATTTGCTAC
TAAACAGAAAACAAATAAATAAATTAATTTTGCTCCAATAAAAGTTTTTGAAGATTTTTG
TTAAAAAATCAATCTATTTCTATCAAATAAAAAAAATGTATTTTAAATAAAACTTATATT
GAGCTCTATTTTTTAAAAAAAGGTGTCGAAGATGAGTTATCAATACAGAAGAAATACATA
GAATGGATTCAAAAGAAGAAAAATAATGTTAGTCTTAGCACTTTTCCTAAAATGCAAAGA
GTGAAACAAGATGACTCAACAGAGTTAGAGAAGATATAGTAGGAAATATTAGAAAATGAG
GATTATTACAATTTTTAGGTGGATAACATTATTAAGTTAAATGCGAGAGAAGAAATTTAA
GCAGAGTTTGAAGGAGAATTTTTAAAATTTCATGGAATAGAAATTAAAGCAGAGAATTTA
TAATACTATTTTACATAGATGACCCTTTTTATTAGAAATTTTATTGGTTTTCAATATAAA
ATTCAATTGAGTTTATTTGAAAAGAATACAGAGTATAAAAAGTAATTCCAACCAAATGAG
TTAAGCAAGGCTTATAAATAGTATAACTTGAACTAAAACTAACTTAACATACTAAGAAAA
ATTTTCAAAAACGGTATAGAACTTTTAACTAATTTTCACTAAATGGCACATGTTGAGGCA
AAATTCATTGATAGCTCCTGCATTTAAAGATTTATTAAAATTTTTGCAATGATTGAACAC
GAGTGCCATTTCAAAGATATAATCGAGCCTAATTTCAAGTTAATACTTAAGTTATTAATA
AAAACCTATCAGGATACTGATAAAAGTTAATGTTAATGCTATAGATAGATTATTGATGGG
GCATTTTAAGAAAGCAGTAATGCTCAACCTGCTAATCCTCCAAATTATTTCCCTACAGCT
AGTTTTTTTAATCATATTCTTTTAAAAAATTTTTTCCTTATTATAGAGCAGTCCAACGAA
ACTATCGATCCTTTTAATGAGTTTTATGGACTTTATAAAAATAAATTCTTTGAAACAATT
TAGTCTTTAATGAAATAAGTATTTATCGGAATCATATCACAATATGACAATGACTCGTAC
AAACAAACTATTAAAAAAAGCATTCTATTTTTATTTAAAAAGATTCACACTTCTCCTTAT
CCTTTAGAATATCTTAAAATCTTGAAGTAATTTAATTTTTAATGATAATTTACCAATTAA
AATCATTATACAATTTAATTTTAAATTTAGATGGTTTTCTTATGAGCTGAATGAATAAAT
CATTAAAAATCCAAATAAGGAAAGTTAAATAAAAAATGAAATATATTCAATATGCTAATC
ACCAGATAAAATGGCAGATGACAAGCATGTTGATCTTCTAAATTAAGAAATTATAAATCT
AGAAAAGTCATTAACTGAAAATAAGGATTTGACTGAAGACAAAAAGTCTTAAATCAAAGA
AAAGCTCAAAATTAGTAAAGATAAATGCAAATATTTTGAAGGTATAAACATATTAGACAA
TATTATTTAGCTATTAGAATTAAATAGTTCTAAATTCTAGGCTTAAATTGCTAAAATATT
CCTCTGCTTACCTAATTTATATAATCAAAACCTTGACTTATAACGTAAGAAACAGGTTGC
TAAAATTCTTTTGATTTGCATCACAATCAATGAAAGAAACTTTGCTACTTAAGCCCTCCA
AAATTTGGAAAATATAATTTGTAAGTTTTATTTTAATGTTTAATTTTTAAAAAAATATAT
TTAAATTATTACAGAAAAGTTAACTAGGGAGGAATTAGAAGTTGCTTTAGAAGATATCAA
AGAAGAACTAATTGATAGATTATATTAAATAGCAAGTGAAAATAGACCAATAGATTTTAC
ATTGAAAAATGAAGAACTTGAAAAATAGATTAAATCAAGCAGACAAAATTAGTAGCAAAA
TATTAATCTGAAATTTACAGATAATTCAAAGATAGCTTTTAAATTGCTTTCAAAATTGTC
ATATCTTACAAAATAACATAAAATACACACTTTTATTTTCGAAAACGAGTCTGCGCCTGA
AGCTTAAGAAAAAATTTACTTAGAATTCGATGTCCTATAAAATAACACAAATGGATAACC
TTAAAAAACTATTTTTAAGCTAGATGTTAAGCAATCTATTGAGCACGCAATTAGTTTATT
TAATAGAATTATTAATAATTTTAATAACTAACCTATGAAAAGTAATGTTATTGATATATC
ATTTGCTTTGATCAAATTTTCTGTCGTTAAATATTTCTGCAGAAGTGAAAATTTAGACAT
AAAATGGCTTTATGAGAACGAAAATGGTGTTAAGTTTTAGGAAAAGTATGCTCAAAAGAG
CTAGCAAGATTAGCAAGAATAACAATAACAAGGTAAGTAAATTGAAGAAGCTATGTAAGA
AGAGTTTGAAGTTAAAAAAAAGATTCTAAGAGAATTTAATTTTGAATAACATGAACAAGA
AGAAGCAGAACAAATTTTAGATAATAAATTTAATTGCTTTTTTGGAACTAGTTCCTCTCC
CAGTTAAAATTCTTCTAATTTACTCATTATGAAACTACTCAAAGTACTGATGGACCTGAC
TTCTATTGATTAAAAAGTTGAAAGGGATCAAGGTTTACTTTTGAAGATTAGAAAAGAAAG
TGAGAGAATTTTAAGTATCATCTCAAAGGTTATCTGCCAGAATATTATTGATTTAGTCTT
GCTCTAATTAGGTTAAAACACTAACTCTAATTAGCTTTACTTCAAAAATCTTTTTGACAA
CAAAAATAGTCCTTATCATGTGTTTATAGCTACAATAGTTAAATCTCTTAAGAACTCAAA
TTTCATGGAGAGAAGAAACAATTAAAAAGCACAAATTTGCAATGAAAAACAATTTTTATG
GAATGAGCTATTAATTAAGAATATTTACAAAAACCTTCAAACTGATGGAGTTAAGCAAAT
AGTTTAACAGATACAATAACAACCAAACTCTAATTAAATGGTGCTAGAACCTTCTCCAAA
AATGGCTAATAACGAAAGCGAGTAAGCTAAATAAGTCATAGATATAGTAGTAGGAGAATT
GGAGAATTTTATTATCTATATGCTCACTAAAGAAATTGGAAATAGCAATGACAGCTTTAT
CCAAACCTCTAATAGCAGATAACTATTTTTCCCAAGCTGTGAAGCAAGCTAACAATAATC
TACCAGTTAGATGATTGGTAGTAGTATAATCTCATCTCACAACTTTGAAAGTCCCTCTGA
TAGTAGAATGTTTGACAACAACAATAATTCCTTGAACAAGCGCTACTGTTTAGTAGAATG
TCTGAATGAAGTGATGAGTATTTTCAAACAAAAAATAATAGGATAGCATATTTAAAATAT
TTTAGAATGTGCATACATAATCTCAAATAATCTACCTGAAGTAGTCAATTTGCAATCTAT
GTAGGATTTCTGTCAACTTTTGATTAAGAAGATTTTACAATACATAAAAAAATAGAAAGA
ACAATATAATATAAATAGTCCTCAATTTAGGAGGATATTATAGACATTTGTGAGCAATCT
AACAACATGCAAGCCTCTTTCTCATTTATACTCAAGGAACGCTCTCAATTCAATTGCTAA
AATTCATAACACAAATGTAATATCAATTTTGTACCTTTCACAAAATGGAAATACGAACGA
AGATGTGAAATTCTGTGATTCTTTTGACTAGCTGATTGCTTAGGCTAAAAAAGAAGATGA
TTTGGCTGATAATTTAGCAAGCATTTAGTAATTAGAATAAATGCCCTCTAAGTACGATTA
TCAAACTTTAGTTAAAAACCACAGAAATTTGTACATATCAGAATTATTAATCTAAATCTA
GACAGCTATCTAAACTTTTTAACATGATTATTTGATGAACAGTAATTTGTACTACACTCA
GAATTCTTAAATAAACAAAAAGCTCTTGTGTATTTTCAATTGCTACAAGAGTTTAGAGTA
TCTGCTTGCCTGTGAAAACTGTCTACCTTTTAAGCTGATAGGTATTTTAAGGATACAAGA
AACTCCTTAAGATTTAAATTTATCAAATTAACAGCCTAAACTATCCTTTTATTTCAAATT
TGATGAAAGCTTTTAAAAAATCATTTAAATTTCTCAAAAAATAATTGATAAAAATAATAA
AGAAATGAAAACATCAAGGATAATACTATCAAATCCCTAAGAAGCAGCTATGCCAAATTA
GATTCCTCCTCTTATAAACCAGGGTTAACCTCTACCTCCTCAAGGAATCAACTCGTCTTA
AGTAATTAATTAGTTTTTTTTTTGTTTTGTTTTTGATTTTTAATTTTTACTTTAAACTTT
TTGATAGAACTTGCTTCAATAACCTCATCTAGCACCTCCTATTAATTAACCTCACTAAGA
TTTAAATTAGTCTATGAACAAAAGCATTCCAGGCAGAGGTTCTGTTGGAGATAATATGTT
TGTAGGTGGACCTAACACACCAAACCCAAGAAACTAAAATGGACCGATGATGCCGCCACC
TCATCCTAATGTTTTACCAAATCACCCACCAAATATGAACCCTAGTAATTAAAATAGCAG
AATAATTAATTAATATGCTAACAATCCTTAAGCTATACAGTAGCCAAATCAACCTTATCC
AGCCAACGCTCCTCCTCCTGCCAGACCAAACAATTAATATCAAGCCAATCCAAATATGCC
TCCTCCTAACCCAAATAATCCAAATTACCCTCCTCCGGGACCTGGCTATTAGTATAATAA
CATGAACAATTAGCCTAATAGACCTATGCCACCAAATCCAAATATAAACAATATGGTAAA
TAAGATAAATTATTTATTTATCTTTGCTTAAAAAAATTTATTTTATACTTAAAAAAGCAA
TAAAGACCAATGAATCCTCCTCCTCCTCCATAAAATTAGCAACAAGCATAGCCTAAAAGT
TAAAATTCTTTTATAAATTAATGCCAACTATTTTATGAAGATGAGCTTGGATTGAATATT
GAGGATCTTAACTTCAACATAAAAAATTGGGCTAAGGTTTTGTCTTCTATTATTTTGATA
TTAAAGTAGATAAACTTATCGATTCCAACAAAATACTTTAACTCATTAATCGATAAAGAA
GAAAAGAAAATAATTGAACAAAGCAATCCAAACTATATCAGAATGCCTCCTGAATTAAGA
GCAAAAACATTTGAAAAAATAGAAGAAATAAATTATTTGAATTTGAATAAATTATATGAA
ATGATGCCAAGGATAGAAAAGACTATTCACTCTACAGTCTAGGAAAGTATAACCGAAATT
AATAAAAAAAATGGTAATAATAATAAAGTTGCGCTGGAAGAAGAAAAGCTGAAGGTTATT
TTAAGGCCTATGCTCGTCTGTTTGCAATCCCCATTCAACAGGTTCACTCCTTAGTTTTTA
TTAATCTTTAAGAAGTTGCTTAAAATGCTAGTAAACTGCTTTAATGGTAGGCTCATTATT
CTCCTGTTAAAATAGCTAGACGAAATTATCAAGGATACAAGTAATCCATTAAATGAATAG
AGTTTTTCAAATTATAAAATAAAGAATGTCTCAGGTGTATTATCTTTATTCTAGCACTTA
AAGAATCCATTCTACTAGCAGAAAGGCAGTAGAGAAGCAGTAAGTAGTAAAGAGCAGATC
AAATAAATTCTTAATTAAACTATAGATATATAAAAGAACTATAGTATAAGATATGGTTGG
CATTATGTCGAACAAAAGACTTTGAATCCAATTTCAAAATTGCTTAATGTATAAACTGAA
TTTGTTACTGAAATTTTGATGAAAGACAAAAAGATTATTTAAAATCCTTAACAGCCAAAT
GATCCTCTAAATTCTCTAAGCGAGTAGACTTTAGAATTTATCTACAAAGTAATCAAGATG
GACTAGGTAAAAAAGAAACATACAAAATTGCGAATTAAATTAAATCATATTTTTTTTTTA
AATTTAGTTTTAATGAAAAAAAAAATTTTTAAAGATTTTGTTTTAAAAAATAGAGCTTTG
AATTGAGAGAAGCACTTACTCGTGAATTCTAAGATTAAGATTTCTTTATGAGATTTTGGG
ATCCTTAGAGAAATTTGCAGCTTTAACTTAAGATTATTTACTTGCTAGCCAAAAAAAGCT
CGAGAGTATTTAAGTAATAAAAGATAGATGGAATTAAGTTTTTAATTGATGAGAGTAAAA
AGATATAAAATATCAATTTTATGAATTACAAGAATTACATCCTCTTTATGAAATTGTTTA
TTTTATACTTCTAGAGAAAGAAAGATATTAACATATTCACTTACATCGCAAGTAATTATA
GTGAAAAATACCCTTGCCCTCACTTCTTAAAGAGATTCTTTGAAGAACAAGTCTCTGCGC
TCTTATCTGTTGAGTAAAAAAAAAGGTTATTGCAGAATACATTAACTAACATGAGTACAA
ACATGGATGTTTAAAACATAAGAATTATGTTAAAGCTAATTATAAAACCAATAATAAAAA
GTTTGACCAAAGAGCAGATTATTTAAATTATTACTCAACACTAAAATTAAATGTAGGGCA
GGCCAGGATAATAATCGATGATTGATTTTTTATTTGAAGCCTAAAAGTAATGAATTAATT
TTATTTTTTTAATTATAATTTTAATTAATTTCTTATAATGCAAAATAAAAAAAGGAGATT
CGATGAAAGATTTAAGAGATTCTAATCTGATCTTTAAAATATTCCCCGTTTATAATAACA
GAGACAAGCCGCTATTTAGCATTAATAGCCAGGATCATTACAAATGGTCCATAAGTTATA
ACAGGATATTAAAAGAATTTAAAAAAATAATGATAGATTTTCAAAGGAGCTGCTATAATT
AGAGCTATGTAGAATAACATTTTTATTTGGAAAAGAATTAAAATAAGATTACCTCAAGAG
ATTTTAGAATCACATTTTTTAAATTATATCAGCAAATTTAGATTAGACTGAGAATCCAGT
CATTAAGCAGCTTTATTATTAACTTTAAATAAAGATTATTAGATTACAAAATTTATAGGG
TGATCTTCAACGTAAAAAGCAACTTCTAAGCAACATATTCAAAGCATACAATTTTAATTC
ACAAGAAACAACCAAAAACCACACTCTTTAGCAATTAATTATTAATAACGTAAATTACTT
CATTAAAAATATAAGCAATACCAAGTAAATTAGACAAGAAAACTAAAGGTAACTTTAATA
ATAGCCACAATCATAGCTTTAGGCAACAGCAGCAATAGCAGCTTAAAATCAATAGTAGTA
ACTTAATGTTCAAAATAAAATAGATTAACAAAGCCAACAAGGAAATTAAAATAATCAAAT
ACAAACTAACTAAGCTATTCCAGCTCTCAATAATAACCTACTAAGTAATTTAGAATTAAA
AACTAATTATGAAATTGTGAGAGAATTCTTAGATATGGATAAAGATAAAATAATTTTTAA
TGCTATTATCCAATAAAATGAATACTTCTATGACATTAGAGAAACAGTGGCAATTGACAT
TTTTAAAGAAATAAAAGAATAATACCTCTTTTACAAAAAGAAGGCAGAAAATGAGAAATA
AAAGATTAAAAAATTCTAGTAAACTTTGGATGATGAGAATGGAGGTATCATGCTTTTATG
GGAGCAACAACACGATTAAAAGAATAATGAACGTTCTATATTTTTGATAAACTTAATAAA
TACATATGTTTATTGGAAATTTAGAGAAATAAAAGAGGAGTCTAAAAACAAAGAAAATGC
TAACACCTAAAAGATGGAAGTATGTAAAAATTCAGAAAGAAAGTTCTCTAAGCACGCTAT
TCATTTACTAATTCACTTCATCTTTGACTTATCAGAGGAAAGAATCGAAAGTTATCAGAT
CCTTCTCAAAAAATGTTTAATTTTATGGGTAATTTAATTAATTATTAATAATTTAAAAAT
ATTTTAATATAATTAATTATTTAGAATAACTCGAAGATAGACTATAAAATGATTAAATAT
AAATACATTTTTAATATGCTTAAAATGGACAATGAAATTACTTAGAATTAGTAAAAGATT
TCTTACGCAAGACCTCACGTTAACAAATATTGTCTTTTTGTTCTAAATATACTAAATATC
TGTCTTGAATGCTCATCTTATACAGAAACTAACTATAATTATCAGATCAAAGATTTCCTC
AAAATTCTTAATTGGTCAACTCTATATGTGCTTAATAAGTAAAAATAAAGAAATAAAAAT
CCTTCAATTTCAGTTCCTAATAGCGCAAATCCTCAACAAAACCCATAGCAATAACCAAAC
AACAATACTACTACTAATAATAATCTACCAGGCACAACTCCTCAAGCTCAAGGGTCAAGT
CAAAATTAAAATTCAGTTACACCAGATGGCGCCGGATAAGGATAAAAAAATATGATGTAA
AAAAATGTAATGCCTAACAACCAAATAAGTAACTAATTAATTTATTAATATATTATCAAT
TAAAATTTATTATTTATTAAAAATAATTTCATATTAAGTTTTTTAATTTTATTTTAAATT
TCTAAGATTTTATTAAATTAATTCATCTTTTCTTAAGAAAAATAAGAGAAAGCAATAATC
AAGGAAAGGAAAGAATATTTTAGTTTGATGAATACAAGCGAATTAGAACCATATATGGTG
ATTATGGTAGCTAATATTTTGTATTCACTTTTGAATGTCTATGAAGAAGACCCACACGAC
AAATAAATTAAAGAATTCAAAGCTAATCTCATTAATTAAATTAAGATAAATATAGAAACA
CACCATTTTTAGATTGATGGATAAGAATTGCAATCCTAAGAAGTTTAACCTCCTATGTCA
GTAGACTTGATTGTCAAGTTGATAATTTACCAAGCTAATTTAAATATAGAAGATCTGTAT
ATCATCAGATTAAATTAAATACTTATGATTTTGGAAAATCAAAATAAGAAGCATAAAACA
AAAGAAGATGATAAAATTCAGTATGATAAATTATTTTATGAAAACTTCTTCTGTTAAAAA
TATGCAAATTATATTCCTCATAATAGCTGCTTCTATTTCGAAACAAGTAAATTAAGTGCC
TAAAATTTGCTTAGTAAATTTTATGAAGAGAAAATTGAAATAGAATAATAACAAGGAAAT
GATGATTTCTTTTATTAAGAAGCTACCTAGTAGTTATAAAATAGGAAAAATAGATATGTT
TAATTACTTAAAAGAGAAGCCGGATTTGAGACTATGTAATGGGAAATCGATTAACACCTC
AAGTATAGTATTAATTTGTTCAGAGATCATCAAGAATTCTTTGAATTCCCTTTTATTAGA
TAATATAGTAGCAACCTAAGCAACTTTTTAAAATATTCTTAAGCTCAAAATTTACTAGGA
TTGATGTATATTAGCTTGTGTCTTCTACCAGCTATCAAGGAAAAGAATTAAGATTCCTTG
CTTTAAAATATAAAAAGAATTCTAAAAGTACTTTTTAATGTAGTCGATGAAGGCGTTCAC
TACTAACTAAGAATAGAAGCTTTGAATTTGCTTAGAGTATTTTTCTTAGGTAAAAGCAAT
TTCCCAAACAGTGAAGTCCCATAGAGATACACAAAGATTGTATAGATTATTGACTTGCTA
TCATTTAAGAGCAGAGATGAAATTATCTAATGGGTATTTGTGTATTAAGATATAGAAAAA
AAGTATAGGAAATTCCCCAAAAATTACTATTACTGCATTCCAGAAGAAATTGGATTTTCG
AATACTACAAGAATAGCAGAGGAGAACATTCAATTTTATTTCTTTAAATTCTTAGTTGAT
ATCTTAAAATTAACTGGAAGTTCATTGAAAAACATCTCTCCTGTAGAACTCAGAAAATAT
TTAATTATTTTCTCCAAACTTTAATCCTCAAATAATTTAGAGTAATAAAAAAAATTTCTT
AAAAAATTCGAAAGAAATTTTTTTATTTAATTGCCATAAAAGCAAATTAATTTTTGACTT
ATTTATGAAATTTTACTATCTATCTTTAAATTAATAATAAAATAAATAGGTATTTATTTG
ATACGATAGAGCAAACTGAAAATATGAATGAGCTTAACTCGATGTTACTCATTCTTGGGC
AAGCTAAGTATGAAGAGAAACTGTTTGAAGGTAGTAGCAGCAGCAGCAAAGAAATTACTG
AGGAATTGCAAACTCATTTGCAAAAAGACGAAGGTGATACTTCTTACTACGAAAATGATG
ATGTTTATTTGTTTGCATATAAATACCTTCTCTACAAAATGAAAAAAATGTCAACAAATG
TCAAGCTTGTTTTCAAAAACTTCTTTAAGTTCCCTAAGATGGTTATCACTTAATCAGCTA
ACTAATCTAAGAAAATAGTAAATATTTTTTTTATCATAAAGATTTTTTATAAAAATGAAA
AATAAATAGGCCAAGAATCAACTTTGTGAGGATGTTCAAGACCTTTTAGAAGAAATTCAT
GAATTCGATTAAAAAAGTTAATTACAGTGGGTTCTGGAATGTGTTCAAGACATGACTTAA
AGCTGCTCTAGAAAAACTACAATCGCAAACGACTTCAAATAAATTTCCTCAATTGAAGAA
TTCAGATATATTGTCCTTGCTTAATAAAATGTTTCCAAATATACACCTCTAAATATTCAA
CTTATTCAACCCTCTTTCATATCATTAATTAAGTTCTTAATCGAGTCAAGCTAGACTAGA
GCAATGAGAGTGCTTCTTTATTAGTCAATTGAGGAGTACTTACTTTTCTTTTAGAGCCAG
TAATATAATACCTACGGTAACAGAGCATATTCAATTCCTGGTTTCTAGTAAAATGAAGAT
AGAAGAATATCGAAAAACTGGGCGTATGCTCTTTTTAATGTGTTTTTCTTTGAGTTCAAC
TAGAAAAACCCATACATAATAAACCCTAATAGAGTTTACCAAATGATAAAAATTCATCAT
TGTTGGGATATTGGGTTGATTTATCTAGAAAAAACTGCTGAGATGATGAATGAAAATTTA
TTAGAAGCTGATATTCAAGTTTATGAAAAAATATAATAAATTTACTAGGATTTAGGAGAA
ACTGATTACATGTATGGAACAATGAATTAGCTTATTAGAAATGATAACCTTAGGAAGGCT
TTGTGTCTTGTCCAACAAAAAGAGTTCTTGCAAGCTCAATAAGCTTTAATAGAAAATATA
GACAAGTTGAATGAAAATGATCAATCACGATGCGATCTTTATTCCTCTCACACTTAAGAC
TACGAAACTCTTTACTTTATTTCCACATATAGATAGCTTTTCATAGAGACATAAAAAAAT
TTAAATGAATGGGACACACTCTTAAATCTTAGCAAAGTTGAGCAGAATGATCACCTACTC
TCAGAATCTTCATACTTCAGCTTGAATAAGAATATGAAAGAACTATCTAGAGTTTTAGAT
AAGGATTTGCTAATTTTGAAAGAAAGTAAAGAGATACCATGTGAGTACCAAAACTTTTAT
TTCCAGCCATCATTTATGTATCATCATGTAAATATCTTGTAGTTATTTAATAAGCGTGTA
TAACTCTTGTAAATTGAGTAAAGTCTTCAAAAAGCAAGTGTATAATTAGCATATGAATGG
TCTGCGCTTCCAAAAACTATTACAAAAGCTCATTACAATCTAATAACTCAGCTTTAAGTT
ATTACAGAATTAGAAGAAGCGAGTAGAGTATATGGTAAATTAAAAACTGATGAGTAAAGA
TATTTCTAGTCATCCCTTCCTACTTTTGACTAGATGACTTTATAATGGTAAATTATTTAT
CAATTTATAATTATTCTTAATTAAATAAAATATATGATTTTAGGAGAGAGAGAATGCCAC
ATAAATATGACTCACTTTTGAACTGGAAAATACTTGTGAATCAAAGAGAGTTCATTTAAA
ATACTTTCTTTGATATTATTAAATAGATAATAGATAGAAATATGTAACAGTAGCCAAATC
AAAATTTACAAAAGCATTACAAAGAAAATCTTTTGATGCAGCATATGGATTTAGACTATA
ATAACTATTAATACTTTAAGGTTCTTTAGGTATAAATTAATTATTATTTAACAAAAAATT
ATTATTTTTAAATTTATCTAATAAATAAATAAATAAATAAATAAATAAATAAATAAATAA
ATAAATAAATAAAGAATTATGGCATCACAAATATGAATTTATTGCCTCCCAGAAGAAATG
AGATTGTGCCAATTGAAGATACTTATTTAAGGCTAAAATGCCTGATGAGAAACTCTCTAA
TTGACAATAGCTCTACTACTGAAGAAAACATATAAGAAATAAAGAAGATTTTCGGTGAAA
CTATACAGAAACACATGTAAAGTGAAAGCTAAAAACAAATGAACCCAATGAATTTAAAAC
CCTATTTTGAATAATTGCAGGAGTAAATTAATCTAAAACTATCTCAAACACTATTCAAAA
AAAGTAATTTTTTTTAAATCCTTTAAAATAATTAATTTTTGTTGAATAAAAATTATTTAT
TTTATTTTAATTAACTTTAACAATAAATATTATTTTATATTTTTCTTAGAATTTATAATA
AATTAAGCAAAAAGCTTTTAATTTATTGATAAATAATTCAATAAATAAATAAATGAAAGA
TTTTAGCATTTCTCCTTGCTTCCATTCTATTTTTTTTAATTTGAAATTTCTAAATTAGAT
AAACATTTTTTAAAAAAAAAAACATAGAAAATTACTTTGAAACAATTCAAAATATAAAAT
CGCTTCTCAATAGACCCTACAATCTTCAAAAGATATGCTATACTTACCTTGAGATTTGCT
TTAGTATTTTGAAATCTGAGAAAAATCACACAGATTACTTCAATAAAATGATAATAAGTT
TAATGGGAGAAGCTTTAAAATATAAACCTTACTACTCAAGAATGTATTTTGTTTTGTTTT
GTTAACCTGAATTTATTGGTACAAACTTCGATTAGATAGCCTAAATTTAAGATGCTAGGA
GTTTGTCTAATTAATTAATTTTATGGTTGCCAAAGATTTTATATATGTATTAAAAATATA
AAGAGTAAAAGGAAAGTAATAATATTGCATAGGCATATATAAAACTATTAGAACTTCTTA
GACAATATGATTAATATTTATTTTTAACACTAAGATCATATTTACCATAAAAATAAGAAA
AGAATGCATTATAATAAATTTATTTGCAAATGAGAGAAAGCATCTCAGGCAGAAAAATAG
AATCTCTTTTCAAGACTCTAAATAGCCCATTGACAGAAGATCCAAAAAAGCTATTCCTTA
CTTTAGAAATGAGATACTAAGAGTTGGATTAAATTTTAGAGCTAATTTAAAATCTTCCTA
GCTTAGAAGTTTATAAAGATATGCTTGAAAAATAGTTAATTTATTAATTAGAGAGCTCAA
CTCAAAACTTACATAAAATTATTCCTGAATTTGTTAAAATTTAAAGTGTTTATTAATTCA
TTAATTCTGAATCTCCTCCAAGCAAAGTTATAGATTTTATACGCACTAAGCTTTACGCAG
GAATAATATAATTTTATAATAAAAATAAGAATTTATTTAATCTAGAATATTCTGTTAAAA
GCCTTCTGCAATTTTAGTTAGACTCATAAGATATTGAGATTCCTGGCTAGTACGTAATTA
ATAATCCCCGAATTTTTAGAGAGTTTGCTCCTAAAAGTCACACATTTATGTCTTCTTTGA
ATAAAGAAGTAGAGCTTTATCCTTCTTACCGCAAATTTGTTAAAAGGATATTCATAAATG
CAACCAACTGCAAACAGTAATTAATTAATTTGAATTCAAAATTTTTGTTCATATTTAAAT
TCACACATAAAATTATTTTTAAAATATTCTGATTATAAATAACCCATTCAAAAAAAAAGC
CATATAAAACTTATTAAAAAAATGTAAAACTAACAAACAATTCATTCTAATAAGCTTTTA
ATTAAAAAATAAACAAAAAAATGAGGAAAAGTTTATCTATAAATAAATAAATTAATTAAT
TAATTTTGTTTTAAATTTAATTAGTCAAAATAACATTCAAAAATATTGTTTTTATTTGTA
AAAAATTAACTAGATATGCGTATGAATTTGATTACGATTACTAACATGTGTATAAAAACG
GTGTGTACTATCAGCCTTGCTCTGAAGAATTAAATGCTCATAGATAGCTATAAATAGGAA
TTTTATAGCAATGTTTAAATAGCTAGTTCTTTAAAAACAGAGAAACAAACACCAGAAATC
TTAAATTATCTTAGCGTGTGAGACTTCCTTTGAATAGTTTAAATCAGTCTTAAATATTAT
CTTTGAAAGCAAGTTCAAAAACTTTATATTCAATGTAAACTGTACACGATTGGTATTTAA
CCTAATATTGCTCTAAAAGTGATAGCAAATACATTGATAATTTTAACACACACTTGGATA
TATTTAACTTCACAAACACAAATGATATTAATAAAAGCATGAAGGATTTAGTTAAAGGAA
ATGCCCTTTGTCAGTTCATTCTATCAAAATGCAATACCTATTAAGAATATATAGATTTCC
GCCAAGAATTTTCATACAATTATGCAGCTGCTTCTTTCTGCAATTACATACTAGGAGAAA
GCGTAAGTCTATAAGATATCTACTTTGATTACAATACAGGAGAAGTCTTTATAGACACTA
AAAATCTGGAGATTAGAAATATATAAAATAAGGGCAATTAGGTCATATACAAGAATCATC
ACTCCATTCGTATTTCTAATTCTATTGCTAAATTCATAGGATAAATAGGTATTTCAGGTA
TTATGTGCTCATCTTTTATAGCGATGGCTAAAGCAATTACAACCAAAGAGTAAAAATTTA
TTATTTATTTTTTTTTTTATTTATTTACTTTTAGTTTATTTAATATAATAAATAACTCAT
AATTTAATATTAAAAGGTTCCCATTCATTCCTGCTATGTAATCAGTCATAGAGGACTTGT
TATCTTTAAATAATATTCCAGGAGATAAGTAAATAATATTTGATCAAATAATTTAGAAAA
TCTTATGGATCTACAGCTAAGAGTACTAAACAAATAATTTCTCTAAAAATGAAATTTGCA
CTCGCGTTTACACTATATTTGACACTATTCAAGAGAATTAGTTAAATGTTTATAATCCCA
TCTCTTATAAATACTGGTTTTGA