Identifiers and Description

Gene Model Identifier

TTHERM_00854280

Standard Name

TPT1 (tRNA 2'-phosphotransferase 1)

Aliases

PreTt12253 | 151.m00066

Description

RNA 2'-phosphotransferase, Tpt1 / KptA family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring phosphorus-containing groups (IEA) | GO:0016772

Biological Process

  • tRNA splicing, via endonucleolytic cleavage and ligation (IEA) | GO:0006388

Domains

  • ( PF01885 ) RNA 2'-phosphotransferase, Tpt1 / KptA

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00854280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13254.18.001476333098533e-119RNA 2-phosphotransferase, Tpt1
/KptA family protein (237 aa)
DictyBaseDDB_G02869295.0020095550341075e-51DDB_G0286929 on chromosome: 4
position 5090123 to 5090773
OxytrichaContig3963.0.g428.001824328206442e-49RNA 2-phosphotransferase, Tpt1
/ KptA family
SGDYOL102C9.99967697349061e-30TPT1 tRNA 2-phosphotransferase
, catalyzes the final step in
yeast tRNA splicing: the trans
fer of the 2-PO(4) from the sp
lice junction to NAD(+) to for
m ADP-ribose 1-2cyclic phospha
te and nicotinamide
Stentor CoeruleusSteCoe_237251.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25303953: Cranert S, Heyse S, Linger BR, Lescasse R, Price C (2014) Tetrahymena Pot2 is a developmentally regulated paralog of Pot1 that localizes to chromosome breakage sites but not to telomeres. Eukaryotic cell 13(12):1519-29
  2. Ref:24297442: Premkumar VL, Cranert S, Linger BR, Morin GB, Minium S, Price C (2014) The 3' overhangs at Tetrahymena thermophila telomeres are packaged by four proteins, Pot1a, Tpt1, Pat1, and Pat2. Eukaryotic cell 13(2):240-5

Sequences

>TTHERM_00854280(coding)
ATGAAAAAGAGTTACGGAGGAAAGCGTAGAGATGACAATCCAGATGTTGGATTATCAAAG
AAGCTTGCATGGCTTTTGAGACATGGCGCAGAAAAGGAAGGTCTCAATATGGGTTCTGAT
GGCTATGTTTTACTTTAAGAGATCATGTCCAGAAATGATTTCAGTACCATAACATTCGAT
AAAGTTAAAAGCGTGGTAGATAACAACGATAAGAAAAGATTTGAAATGATTTAAAAAGAA
CATAACGGAAAGATTGAGTGGTTTATTAGAGCTAGTTAGGGACATACCATATCTTCTATT
AACGATGAAGAGTTATTGGACAAAATATCTTTAGATGTTGCATCTTCTCTTGGAATCGTT
GTCCATGGAACATATAAATAATTCTGGGAACCTATATCTAAGGAAGGTTTAAAGACAATG
CAAAGAAACCATATTCATTTTGCTATTGGATATCCTGGCGATAAGGAAGTTATTTCTGGA
ATGAGAAAAACTTGTGATGTATACATTGAAATAGATTTAGTTAAGGCTATTAACGATGGA
ATTGATTTCTTTATGTCAAAAAATAATGTAGTTCTAACTTCTGGTATCAATAAAGTTTTA
CCTCCCAAGTACTTCAAGGTAGTTAAAGATAGAAATGGAAAGATCTTATTTGCATAGCCT
GAAAAATTAGTAGAATAAAAAGATGATAATAAAGAAGAAATAGAGGAACAAAAATAAAGC
AACTGA


>TTHERM_00854280(protein)
MKKSYGGKRRDDNPDVGLSKKLAWLLRHGAEKEGLNMGSDGYVLLQEIMSRNDFSTITFD
KVKSVVDNNDKKRFEMIQKEHNGKIEWFIRASQGHTISSINDEELLDKISLDVASSLGIV
VHGTYKQFWEPISKEGLKTMQRNHIHFAIGYPGDKEVISGMRKTCDVYIEIDLVKAINDG
IDFFMSKNNVVLTSGINKVLPPKYFKVVKDRNGKILFAQPEKLVEQKDDNKEEIEEQKQS
N


>TTHERM_00854280(gene)
ATGAAAAAGAGTTACGGAGGAAAGCGTAGAGATGACAATCCAGATGTTGGATTATCAAAG
AAGCTTGCATGGCTTTTGAGACATGGCGCAGAAAAGGAAGGTCTCAATATGGGTTCTGAT
GGCTATGTTTTACTTTAAGAGATCATGTCCAGAAATGATTTCAGTACCATAACATTCGAT
AAAGTTAAAAGCGTGGTAGATAACAACGATAAGAAAAGATTTGAAATGATTTAAAAAGAA
CATAACGGAAAGATTGAGTGGTTTATTAGAGCTAGTTAGGGACATACCATATCTTCTATT
AACGATGAAGAGTTATTGGACAAAATATCTTTAGATGTTGCATCTTCTCTTGGAATCGTT
GTCCATGGAACATATAAATAATTCTGGGAACCTATATCTAAGGAAGGTTTAAAGACAATG
CAAAGAAACCATATTCATTTTGCTATTGGATATCCTGGCGATAAGGAAGTTATTTCTGGA
ATGAGAAAAACTTGTGATGTATACATTGAAATAGATTTAGTTAAGGCTATTAACGATGGA
ATTGATTTCTTTATGTCAAAAAATAATGTAGTTCTAACTTCTGGTATCAATAAAGTTTTA
CCTCCCAAGTACTTCAAGGTAGTTAAAGATAGAAATGGAAAGATCTTATTTGCATAGCCT
GAAAAATTAGTAGAATAAAAAGATGATAATAAAGAAGAAATAGAGGAACAAAAATAAAGC
AACTGA