Identifiers and Description

Gene Model Identifier

TTHERM_00077390

Standard Name

TPS2 (Trehalose-6-phosphate PhoSphatase)

Aliases

PreTt10085 | 5.m00436 | 3828.m01345

Description

Phosphatase subunit of the trehalose-6-P synthase/phosphatase complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00686 ) Starch binding domain
  • ( PF02358 ) Trehalose-phosphatase
  • ( TIGR00685 ) trehalose-phosphatase
  • ( PF00982 ) Trehalose-6-phosphate synthase domain
  • ( TIGR02398 ) glucosylglycerol-phosphate synthase
  • ( TIGR01484 ) HAD-superfamily hydrolase, subfamily IIB
  • ( TIGR02400 ) alpha,alpha-trehalose-phosphate synthase (UDP-forming)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00077390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07094.19.997093137033517e-262trehalose-phosphatase (785 aa)
DictyBaseDDB_G02849757.998505003885351e-50tpsB on chromosome: 4 position
2735507 to 2737979
OxytrichaContig13350.0.g519.004005705510192e-49Glycosyltransferase family 20
SGDYDR074W4.998978211117678e-38TPS2 Phosphatase subunit of th
e trehalose-6-phosphate syntha
se/phosphatase complex, which
synthesizes the storage carboh
ydrate trehalose; expression i
s induced by stress conditions
and repressed by the Ras-cAMP
pathway
Stentor CoeruleusSteCoe_25413.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00077390(coding)
ATGATCATAGCAGATTGCGAAGTTAAGTTCGAAATTATATGCAAAACAGCGTTTGGGGAA
TAGCTTATTATCGTAGGCAATACTCCCCAGTTAGGTAATTGGAATCCATACAAAGGAATA
GTAATGAAAACAGATGATGATAATTACCCAAATTGGTACACTGAAAATCCTTTGATGTTG
CAAAAAGGATCCAAATTTCAATTTAAATTTGTAAAGCTAAGACAAGGCAACTAAGAATGG
GAGGTTTTTCCCAATAATTTGAATAGAAAATACAGAACCAGGTATCAATCAGTAACGCTG
AAAGCAGTGTGGAATGACTTTTCAGGAAGAGAAATTCCAAATAAAAAATATGCCAGCTCT
AATGTCTTTTCAAACAATGAAATAAAGGTGCATAAATTTAAAATATCGGGAGTATTCGTT
CCTTATGAGCAAGCAGGAACAGATTCCTCGAACGATTCTGATTTCGGAGCAGCAAAGAAA
ATAGAAGAGCATGATGAAAATATAGACTTTAACAAATAAAATAATTTTAAAGAAAATAAT
AATAACAATAATCCTGCTACAAATAATGATAGTGATAATTCAACTTAAATAGTAAAGAAA
AAATTACAAAGACTTCCTTAACCTCCACTACCCTTGATGCAATAAAATAACAATTTTGAG
TAGGAATAGGTTTAAGTACTCAACTTGAAAGATGATAAAAGCGCAAACTAAAATAAAGAA
CAAGCTAGTCCTGTTTCTTAGGTTCCATCCCACAACCATTAGAAATAACCCAGTAGTCAA
TAAAATAATTATCACATCAGCTATAATAATTAGCAGCACTTGCTCAATTGTTAATAATTT
TTATATAATGCAAACCACTAAAAGTAATTTGGTACAGACGAATAAATCAAAACAAATGCT
TTGCTTCTAAAAAGCCACTAAATTAATCATATTTAAGATAATGAAGATATCAAAAAGGTA
TCAAAAGGTGAGCAACAATAAGTTTAAAGTTAAGGCGTTAATCTGAGTCATGATTAGTCA
CTTCCAAAATTATTATAAAAGAACATTAAAAATCCAATATTCAATACTTAATTTAAAGAA
TATGAAATATTTGGCAAGTAATAAATAAAACCAAGTAGCAAACCTGCATCTGAATTTGAT
GAAAATGCGAGTATTTAGAATGAATTTGATGAAATGAATGTCACTATTAATAGCGCTGCT
AGCAGCAACACTACAAAAGCTCTCTAAAGAGGCAATCAGATTAATAATTCTTCTCTTTTA
AATCCATCTAATTTCAAAAATACTGATTCTATGCAAACAGTATAGGTTATGGGCACACAA
GATCATTCCCTGATTGAAGCCTCTGGAGCGTAAAAGAAACAACTGTTTGGCAAGAAAGTA
AATATCTAAAAAATTGGAGAAAATGGAGACATATTAAATGTTGACAGCTTGAGTGATTAA
GAAAGATCGGAGAGCAATTTAGATAGAATGAGCGATCTCAATTCTAATATGAGGAAAAAC
AAGCTTTTACCTCGCAAAAACTTACAATTTACAGGATTAACTTCGGAAATTAAAGACACT
GATCAAGAAACAGATAATTAAAGCTTAGGAGATCCTGAGCTGCATAAAAAATTAATTCGA
AAATAAAAAATGATAGATCAAGACTCTCCTGGAGTGGAAGAGGAGGATGATTTTGAAGAA
AATAATTTAAGAAATAATAAAGATTAAGAAAGCGATTAATCAGGTTTATCATCATAAAAA
AGCCAAAAAAAATTGGCAAGCCTGAATAAAGTTAGCGGAACACTTTCAAACAAGTCTGAT
GAATGTGGTCTTATATAAAGTGAATAAAGCCTAAAAAGTAAAATTAGAAAAGGAAGAAGA
CAACCTACTTAATAAGAATCCATTTTTGCAGAAAAACTATTCTAGTCTTCCGGTCATACC
TTGCAAACCCTCTTCTAAGAAAAAATGAAAAAAATTCATGAAAAAAGCATTATAAATTAA
AAATACTCATTTATAACTTCAGAAAATGATATTGTTTTTGAAGCAAGTGAAGAATTTCTT
GTTAACATGTCTGAAAAAGATGAGCTTTGTCTTGCTACATTTTTCCTGCCTATTATAGTT
ACATATGACCAAGCTACCGATACCTTCAAAGAAGAAATCTAAGAGTCTTCACTTTATTTT
CACTTTTACAACTCATATACAAGCCTGAGATGGGTAGGTGTTTTGCCAAATTACTATTAA
ATTCCATCTAATTTGCATGAAAAATTAGCTAACTATCTTATGTACAAATACAGATTTTAT
CCTGTTTTTATGGAGAATGAAATGATTGATTCTTTTCTAAACAACTTTTGTTTCAACATG
TATGATAACATTATGACAAATCAATTTGATCTCTAACATTTCAGATTTATAGAGTATAAT
TCAAAGATATTTGAAGAAGTCAAAAAAATAAGCTTTATATTTGCTTAGTAAATAAGTAAG
ATTATAGATGTTGATACAAACATTATGATTGCTGATTACAGGATAATCTTTTCTATCATT
TATATTTCATAGTGTAGAGCAAATAAACTGAGTATAGCTTATTTTCATGATTCGTAGTTC
CCTGATATTGATAAGTTAATGATACTTCCTTTTGGAGAAAAGCTCATTAATGCCATTCTA
TGCTCTAATATGGTCTCATTTATGAATTTTGAAGCTGCATAAAATTTTTTGAAGTTTATA
AGAGTGAAGTTGAAACTTCCTTATGAGTCAATTCGTGGTAATTTAAGACTAATTTATATG
GGAAACCAAATAATTATCCACATTAGAAACCCTGGAGTAAATATAAAAGCAATTAATTAC
ATAAAGCATTAACAATATTATGAAGAATATGTGACAAAAATAAGAGTGAATTAATTAAAC
CAAGATAATCAATTACTGATGCTCTCTGTGGATACCTTGCACGAAAACAATAAAATTGAA
TTGAAATTTAAACTATATGAGAGATTTTTGTGTAATCATCCTGATCTCAAAGTTTAATTG
ATTTAAATCATACTTCCTGAATAAAAGAATTATTCTACTCAAGGAAATTATAGTAATAAA
GAACTCATGAAAAGCATTAACAGGATTGCTAATGAAATTCAAAAAAATTTTAGGAGCAGA
AATCCGCTTCTGGTTATTTATCAAAACATGACTCTCAAAGAAAGACTGGCTTATATGAAA
CTTGCTGATATATTTTTGAAAACTAGTGTTTTCTAAGAAAATGAAATATATCCTTTGGAG
TATGTGTTAGCCAACCAATAAAGTGGATTTATATTGATTAATAAATTTGGATCTTACAAT
TACAAATAAATCAGAAGTTGTATAGCTTTCAATCCAAACAGTTACTATGAATTTGAGAAA
AATATACTCGATATTTAATCTCTTTCGTTGTCCTTAAAGGAAAAAGTACTTTCCAAAGAT
GTTGAAATTTTGTAGCAATTCAACACTAACACATGGATTGAAAAGCATATTGGAGAACTA
AAAAAGAATGCAAAGTTTATGTCTCAAGCCAACATGACAGGGTCAAACAAAGGAATTAAC
TTTAAAAAAGTTGCTCATTCTGCATATTTTAAATAGCTAAACATCAAAGAAGCAACAGAG
TTTTATAGAAAAAGTGTGAGAAGATTAATAATATTTGGATACGTTGGCACTCTTGTTCCA
TTAGATAAATACATGTATATTCAAGCTGAAGAGTATTAATTAAGAAGACATCACTAAAAA
CCTTCTGAAAAGATGATTGAGAATTTAAAAAAGCTATGTGCTGATAAAAGGAATATGGTT
TATATAGTAACAGAACTATCAATAGATTTCATGGATGAATGGTTTTCAGATGTAAAAGGT
TTGGGATTAATATGTGAAAACGGTTACTTCCACAAAGTGATCTAAGAAGGAGGAAAACCA
AATACAGAGTGGGTTAGGTTAATTGATTTGGATATGAGCTGGAAAGAGCCAGTTTATAGA
ATCATGGAAAGCTATGCTATTAGAACTCAAGGTTCTTCTGTAGAAGTAAAAGAAAGTAGT
GTAATATGGAAATATAACAAAGTTAACATAGATTTTGGGGCCAAGTAAGCAGAATAACTA
TTCCTACAATTAGAATCTAATATTTCTTAGCTAAAATACTTAGAAATATCACACCATAAC
GAAAGTGTAGAAGTTAGGCCTTGCAATCTAAATAAAGGAATAGTTGCAGAGCTGCTAATA
GAAAGGAAAATCATAGAGTGTGGCAAAATAGATTACATTTTAATATTGGGAAGCAGCATG
ACTGACGAAGATATGTTCTGTGCTTGCCAAATGTTTTACAGAAATCATAATAAAGAATTT
TAAGAAAAAATGAAACCTCTTTATGTGACTATTGGAATAAAGCCATCAAATGCTTACTAT
TACATAGCATTTGAAGAGGTAGAAAAAGTGATAGAATTATTAGTATTATCAGAGTCTTTT
GCATCTTTCTTTTGA


>TTHERM_00077390(protein)
MIIADCEVKFEIICKTAFGEQLIIVGNTPQLGNWNPYKGIVMKTDDDNYPNWYTENPLML
QKGSKFQFKFVKLRQGNQEWEVFPNNLNRKYRTRYQSVTLKAVWNDFSGREIPNKKYASS
NVFSNNEIKVHKFKISGVFVPYEQAGTDSSNDSDFGAAKKIEEHDENIDFNKQNNFKENN
NNNNPATNNDSDNSTQIVKKKLQRLPQPPLPLMQQNNNFEQEQVQVLNLKDDKSANQNKE
QASPVSQVPSHNHQKQPSSQQNNYHISYNNQQHLLNCQQFLYNANHQKQFGTDEQIKTNA
LLLKSHQINHIQDNEDIKKVSKGEQQQVQSQGVNLSHDQSLPKLLQKNIKNPIFNTQFKE
YEIFGKQQIKPSSKPASEFDENASIQNEFDEMNVTINSAASSNTTKALQRGNQINNSSLL
NPSNFKNTDSMQTVQVMGTQDHSLIEASGAQKKQLFGKKVNIQKIGENGDILNVDSLSDQ
ERSESNLDRMSDLNSNMRKNKLLPRKNLQFTGLTSEIKDTDQETDNQSLGDPELHKKLIR
KQKMIDQDSPGVEEEDDFEENNLRNNKDQESDQSGLSSQKSQKKLASLNKVSGTLSNKSD
ECGLIQSEQSLKSKIRKGRRQPTQQESIFAEKLFQSSGHTLQTLFQEKMKKIHEKSIINQ
KYSFITSENDIVFEASEEFLVNMSEKDELCLATFFLPIIVTYDQATDTFKEEIQESSLYF
HFYNSYTSLRWVGVLPNYYQIPSNLHEKLANYLMYKYRFYPVFMENEMIDSFLNNFCFNM
YDNIMTNQFDLQHFRFIEYNSKIFEEVKKISFIFAQQISKIIDVDTNIMIADYRIIFSII
YISQCRANKLSIAYFHDSQFPDIDKLMILPFGEKLINAILCSNMVSFMNFEAAQNFLKFI
RVKLKLPYESIRGNLRLIYMGNQIIIHIRNPGVNIKAINYIKHQQYYEEYVTKIRVNQLN
QDNQLLMLSVDTLHENNKIELKFKLYERFLCNHPDLKVQLIQIILPEQKNYSTQGNYSNK
ELMKSINRIANEIQKNFRSRNPLLVIYQNMTLKERLAYMKLADIFLKTSVFQENEIYPLE
YVLANQQSGFILINKFGSYNYKQIRSCIAFNPNSYYEFEKNILDIQSLSLSLKEKVLSKD
VEILQQFNTNTWIEKHIGELKKNAKFMSQANMTGSNKGINFKKVAHSAYFKQLNIKEATE
FYRKSVRRLIIFGYVGTLVPLDKYMYIQAEEYQLRRHHQKPSEKMIENLKKLCADKRNMV
YIVTELSIDFMDEWFSDVKGLGLICENGYFHKVIQEGGKPNTEWVRLIDLDMSWKEPVYR
IMESYAIRTQGSSVEVKESSVIWKYNKVNIDFGAKQAEQLFLQLESNISQLKYLEISHHN
ESVEVRPCNLNKGIVAELLIERKIIECGKIDYILILGSSMTDEDMFCACQMFYRNHNKEF
QEKMKPLYVTIGIKPSNAYYYIAFEEVEKVIELLVLSESFASFF


>TTHERM_00077390(gene)
ATGATCATAGCAGATTGCGAAGTTAAGTTCGAAATTATATGCAAAACAGCGTTTGGGGAA
TAGCTTATTATCGTAGGCAATACTCCCCAGTTAGGTAATTGGAATCCATACAAAGGAATA
GTAATGAAAACAGATGATGATAATTACCCAAATTGGTACACTGAAAATCCTTTGATGTTG
CAAAAAGGTAAACCACTTTTACATTAATAAATAAAAGATAAAATAGTCAAGCGTATTAAA
TGAAGACCAATAAGCAAAATTAACTATGTTAGCAGACAATATAAACATGGAGACGATATA
ATTTGTTGTCAATTATCTAGTTAAGCAAAGGTTCATCATTTAATAAGTTGGATATTTTTA
AATTTAAATTTGTCTCCAAGCAAATGAATTAGAAAAAATGCAACAAAATAAGAATAAAAA
GTATTTTTTAGAATAAATAAATAAATCAATTAAATAATAGGATCCAAATTTCAATTTAAA
TTTGTAAAGCTAAGACAAGGCAACTAAGAATGGGAGGTTTTTCCCAATAATTTGAATAGA
AAATACAGAACCAGGTATCAATCAGTAACGCTGAAAGCAGTGTGGAATGACTTTTCAGGA
AGAGAAATTCCAAATAAAAAATATGCCAGCTCTAATGTCTTTTCAAACAGTATATTTATT
TATTGAAATTAGAATAAAATTATTCTGAATTTGATATTTTGCATAATTAATTTATAACAT
TACTACACTATTATTGAAACTTTATAATTTACCTAATTTGCTATCTATCAATTTATTAGC
AAAACAAACTAATATTTTAGAATAAAATTATTTAATTTTACAAGAAATTAACTCTTTTTG
ACTACTCTCATATGTTTTAAATAAAAATTATAAGCCAGTTTAATCACATTTTTTTTATTG
ATGTTGTCATTTTTAAATGTATATATAATATTAAATATCTAAATATAGATGAAATAAAGG
TGCATAAATTTAAAATATCGGGAGTATTCGTTCCTTATGAGCAAGCAGGAACAGATTCCT
CGAACGATTCTGATTTCGGAGCAGCAAAGAAAATAGAAGAGCATGATGAAAATATAGACT
TTAACAAATAAAATAATTTTAAAGAAAATAATAATAACAATAATCCTGCTACAAATAATG
ATAGTGATAATTCAACTTAAATAGTAAAGAAAAAATTACAAAGACTTCCTTAACCTCCAC
TACCCTTGATGCAATAAAATAACAATTTTGAGTAGGAATAGGTTTAAGTACTCAACTTGA
AAGATGATAAAAGCGCAAACTAAAATAAAGAACAAGCTAGTCCTGTTTCTTAGGTTCCAT
CCCACAACCATTAGAAATAACCCAGTAGTCAATAAAATAATTATCACATCAGCTATAATA
ATTAGCAGCACTTGCTCAATTGTTAATAATTTTTATATAATGCAAACCACTAAAAGTAAT
TTGGTACAGACGAATAAATCAAAACAAATGCTTTGCTTCTAAAAAGCCACTAAATTAATC
ATATTTAAGATAATGAAGATATCAAAAAGGTATCAAAAGGTGAGCAACAATAAGTTTAAA
GTTAAGGCGTTAATCTGAGTCATGATTAGTCACTTCCAAAATTATTATAAAAGAACATTA
AAAATCCAATATTCAATACTTAATTTAAAGAATATGAAATATTTGGCAAGTAATAAATAA
AACCAAGTAGCAAACCTGCATCTGAATTTGATGAAAATGCGAGTATTTAGAATGAATTTG
ATGAAATGAATGTCACTATTAATAGCGCTGCTAGCAGCAACACTACAAAAGCTCTCTAAA
GAGGCAATCAGATTAATAATTCTTCTCTTTTAAATCCATCTAATTTCAAAAATACTGATT
CTATGCAAACAGTATAGGTTATGGGCACACAAGATCATTCCCTGATTGAAGCCTCTGGAG
CGTAAAAGAAACAACTGTTTGGCAAGAAAGTAAATATCTAAAAAATTGGAGAAAATGGAG
ACATATTAAATGTTGACAGCTTGAGTGATTAAGAAAGATCGGAGAGCAATTTAGATAGAA
TGAGCGATCTCAATTCTAATATGAGGAAAAACAAGCTTTTACCTCGCAAAAACTTACAAT
TTACAGGATTAACTTCGGAAATTAAAGACACTGATCAAGAAACAGATAATTAAAGCTTAG
GAGATCCTGAGCTGCATAAAAAATTAATTCGAAAATAAAAAATGATAGATCAAGACTCTC
CTGGAGTGGAAGAGGAGGATGATTTTGAAGAAAATAATTTAAGAAATAATAAAGATTAAG
AAAGCGATTAATCAGGTTTATCATCATAAAAAAGCCAAAAAAAATTGGCAAGCCTGAATA
AAGTTAGCGGAACACTTTCAAACAAGTCTGATGAATGTGGTCTTATATAAAGTGAATAAA
GCCTAAAAAGTAAAATTAGAAAAGGAAGAAGACAACCTACTTAATAAGAATCCATTTTTG
CAGAAAAACTATTCTAGTCTTCCGGTCATACCTTGCAAACCCTCTTCTAAGAAAAAATGA
AAAAAATTCATGAAAAAAGCATTATAAATTAAAAATACTCATTTATAACTTCAGAAAATG
ATATTGTTTTTGAAGCAAGTGAAGAATTTCTTGTTAACATGTCTGAAAAAGATGAGCTTT
GTCTTGCTACATTTTTCCTGCCTATTATAGTTACATATGACCAAGCTACCGATACCTTCA
AAGAAGAAATCTAAGAGTCTTCACTTTATTTTCACTTTTACAACTCATATACAAGCCTGA
GATGGGTAGGTGTTTTGCCAAATTACTATTAAATTCCATCTAATTTGCATGAAAAAGTAA
ATTTATTCATTTATAATTTAAAATACCTCTAGTTAAATCTCATTTTTTCTTATAGTTAGC
TAACTATCTTATGTACAAATACAGATTTTATCCTGTTTTTATGGAGAATGAAATGATTGA
TTCTTTTCTAAACAACTTTTGTTTCAACATGTATGATAACATTATGACAAATCAATTTGA
TCTCTAACATTTCAGGTAAGTTTTATCACTAATTAAACAAATTTTATTTAAAAATTATTT
TTAATTTATTTTCATTTTCAACTAAAATTTTATTTTTTAATATTATATATAATAATAATA
ATAATAATTTACTATTTTTCAAAATGCAAAATGCTGATTTATTAAATTGAAAATAAAAAA
AATTTTTTATTTAATTTGAATATAATTTTTTTTTTCAATTTTCAATAATTTCAATAAAAA
GATTTTTTGAAAAATTGATTTTAGTATTTCTGAAAAATTAACTTTAAAATAAATTGAAAG
ATATGAAAAAAATGATTTAAAATTACTTAATGAAAGATTGCTTTAAAAGAATTTTAAAAT
GAATTCACGAAAAATAGATTTAAAATTAATAGAAAAATTAATTTATAAAAAAAAGATTTA
AAATTAATTGTAAAAACAATAAATGAATAAAAGATTGCTTTAAAAGAATTCGTAAATTAA
TTTACTTAGAATAGATTTAAAATTAATAGAAAAATTATTTGTGAAAAATAGACTTAAAAT
TAATAGTAAAAATATTTAATGAAAAATTGCTTTAAAGAATAATAAAATTACTTGAAAAAT
TATTTGTGAAACATTTATTTAAAATTACTCTGTGAATTTGTGATAAATTATTTTTGTAGA
TCAACCAACATAATAGTATTAATTTATTAATATTTATTTATATAGATTTATAGAGTATAA
TTCAAAGATATTTGAAGAAGTCAAAAAAATAAGCTTTATATTTGCTTAGTAAATAAGTAA
GATTATAGATGTTGATACAAACATTATGATTGCTGATTACAGGATAATCTTTTCTATCAT
TTATATTTCATAGTGTAGAGCAAATAAACTGAGTATAGCTTATTTTCATGATTCGTAGTT
CCCTGATATTGATAAGTTAATGATACTTCCTTTTGGAGAAAAGCTCATTAATGCCATTCT
ATGCTCTAATATGGTCTCATTTATGAATTTTGAAGCTGCATAAAATTTTTTGAAGTTTAT
AAGAGTGAAGTTGAAACTTCCTTATGAGTCAATTCGTGGTAATTTAAGACTAATTTATAT
GGGAAACCAAATAATTATCCACATTAGAAACCCTGGAGTAAATATAAAAGCAATTAATTA
CATAAAGCATTAACAATATTATGAAGAATATGTGACAAAAATAAGAGTGAATTAATTAAA
CCAAGATAATCAATTACTGATGCTCTCTGTGGATACCTTGCACGAAAACAATAAAATTGA
ATTGAAATTTAAACTATATGAGAGATTTTTGTGTAATCATCCTGATCTCAAAGTTTAATT
GATTTAAATCATACTTCCTGAAGTATCAAAATATTTTTGATTTCATTTATCTAATATTTT
TATCATTTTAATTAAAAGTAAAAGAATTATTCTACTCAAGGAAATTATAGTAATAAAGAA
CTCATGAAAAGCATTAACAGGATTGCTAATGAAATTCAAAAAAATTTTAGGAGCAGAAAT
CCGCTTCTGGTTATTTATCAAAACATGACTCTCAAAGAAAGACTGGCTTATATGAAACTT
GCTGATATATTTTTGAAAACTAGTGTTTTCTAAGAAAATGAAATATATCCTTTGGAGTAT
GTGTTAGCCAACCAATAAAGTGGATTTATATTGATTAATAAATTTGGATCTTACAATTAC
AAATAAATCAGAAGTTGTATAGCTTTCAATCCAAACAGTTACTATGAATTTGAGAAAAAT
ATACTCGATATTTAATCTCTTTCGTTGTCCTTAAAGGAAAAAGTACTTTCCAAAGATGTT
GAAATTTTGTAGCAATTCAACACTAACACATGGATTGAAAAGCATATTGGAGAACTAAAA
AAGAATGCAAAGTTTATGTCTCAAGCCAACATGACAGGGTCAAACAAAGGAATTAACTTT
AAAAAAGTTGCTCATTCTGCATATTTTAAATAGCTAAACATCAAAGAAGCAACAGAGTTT
TATAGAAAAAGTGTGAGAAGATTAATAATATTTGGATACGTTGGCACTCTTGTTCCATTA
GATAAATACATGTATATTCAAGCTGAAGAGTATTAATTAAGAAGGTAAATAAATAAATAA
ATAAATTATACTAAAAATTGAATTTAAACATTTTAATTTTATTTAATTAGACATCACTAA
AAACCTTCTGAAAAGATGATTGAGAATTTAAAAAAGCTATGTGCTGATAAAAGGAATATG
GTTTATATAGTAACAGAACTATCAATAGATTTCATGGATGAATGGTTTTCAGATGTAAAA
GGTTTGGGATTAATATGTGAAAACGGTTACTTCCACAAAGTGATCTAAGAAGGAGGAAAA
CCAAATACAGAGTGGGTTAGGTTAATTGATTTGGATATGAGCTGGAAAGAGCCAGTTTAT
AGAATCATGGAAAGCTATGCTATTAGAACTCAAGGTTCTTCTGTAGAAGTAAAAGAAAGT
AGTGTAATATGGAAATATAACAAAGTTAACATAGATTTTGGGGCCAAGTAAGCAGAATAA
CTATTCCTACAATTAGAATCTAATATTTCTTAGCTAAAATACTTAGAAATATCACACCAT
AACGAAAGTGTAGAAGTTAGGCCTTGCAATCTAAATAAAGTAATTAATTAATTAATTAAT
TATATTTTACATTTACAAAACATATTTATTTTATTAATATGTTTTTTTTGTGTTGTAAAA
ACAGGGAATAGTTGCAGAGCTGCTAATAGAAAGGAAAATCATAGAGTGTGGCAAAATAGA
TTACATTTTAATATTGGGAAGCAGCATGACTGACGAAGATATGTTCTGTGCTTGCCAAAT
GTTTTACAGAAATCATAATAAAGAATTTTAAGAAGTAAATAATTTTTATTAAAAATAAAA
TTAAAGCCTTACTTTATTTAATGTAGAAAATGAAACCTCTTTATGTGACTATTGGAATAA
AGCCATCAAATGCTTACTATTACATAGCATTTGAAGAGGTAGAAAAAGTGATAGAATTAT
TAGTATTATCAGAGTCTTTTGCATCTTTCTTTTGA