Identifiers and Description

Gene Model Identifier

TTHERM_00616500

Standard Name

TPB7 (Tetrahymena PiggyBac transposase 7)

Aliases

PreTt19199 | 85.m00192 | 3725.m00083

Description

PiggyBac transposase; involved in DNA cleavage step of programmed DNA deletion

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05672 ) E-MAP-115 family
  • ( PF05424 ) Plasmodium Duffy binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00616500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18367.19.997093137033517e-262hypothetical protein (1253 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28087716: Cheng CY, Young JM, Lin CG, Chao JL, Malik HS, Yao MC (2016) The piggyBac transposon-derived genes TPB1 and TPB6 mediate essential transposon-like excision during the developmental rearrangement of key genes in Tetrahymena thermophila. Genes & development 30(24):2724-2736

Sequences

>TTHERM_00616500(coding)
ATGATATAGCTTTTAAAGAAAAGAAGAAGTTAATGGTTTTTTGAAAGCAGCTAAGAGTTT
ACTGAGCAGGAAATTCATGTTAGATAAGAAATTCTCTCTAAACAAGAATAAAAGAACATG
GAATTTTGGTAGAAATGCAAAGAACTTAAAAAAAGGCCTCACCTTTTTTAAACAGAAAAA
AAAATAGACTTAGATCACTACTAAGAAAAAGATTTTGATGAGAAAGATGTCATAGTTATC
CCAATATCAACAAAGAAGAACAATTTAATAATCAATTTAGAAGACTCTCCAATAAGGCAT
GAGGATCACCAACTAGTAGTTTTAGAGGACATTAATGATTGTATAGATATCAGCCAAGAT
AATATAGTACCGAACTTCTAAATTGAAAGAGCTAATGGAAATTTATTGAATATATAAATT
GAAAAAGACAACGAAATTACAAGTGAAAAAATGATCAATGACACATTTTAAGCTGTCAAA
GATAATCATGAAGAGTCGAAAGTAAATGAAGATATTAATGCTAGTTAAGACACTACTATA
TTCAACAGAACACTTGTCTAATAATTCATTAATGAGAGAAAGTAAGCCATTACCGAAAAT
TAGGTAGCTATAGAAGAAAATATCGACAAGACAAAAGAAGCAACTACTGAAACAAATTTT
AACCTTTAAACAGAAAAATAAGTTCAAATATAACATCAAATCAATGAAAACTAGATGTAG
GATATTTCATTTAATTAAGGTAAAGCAGTTGTTAGCGTTTCATCAAGTAATAATCTATCT
GAAAATTAAAAAATTTAAAGACCAATTGTAATAGAAGAAGATAAGATTAATGAGGAGTAG
AATAAATTGGATGATGAATGTTAAGAAGATTAAGCCAACTGGATCTGGCTTCCTTTGAAG
GCTCCATAATAAATTCCTATATCTTACTTTGCCGATTGGAAATTTAAAGGTTAGGATAAA
GTTAATTTGGAGTATGGAAAAAATTATGATGCCTCTACTATATTTAGGATGCTATTTACT
CAGCCTTTATACACTCACATTATTTAAAATATTTACAAAAAATTTAACAAGAGAATAACT
AAGAGAAATATTTTCAAAGATCCAATTGAAATAAACTCTTATGACATAGATGCATACATA
TCACTTTTACTCCATTCTCAATGTTTACAGCATCCTAACTTAATCAATACCATAAATAAG
ATAAATTAAGACATGGATCATCACATTTTAGAGTTTATTTAAAATAACTTCTCAGTAGGA
GCTAAAGTTTAAGATGAAAATGGCTGTTTTAATGAAATTGCAAAGATTGAATAGTTTATT
TCTATGGTTAACTAAAGGTTAAAGTAACTAGTTTAACCAAAAGAGTATCTATAATTGTTA
CATAAAACTATAGAAGGTAACTATTTTAAAAGCAACTCTCAATATTTTTTGGATGAATTC
AGATTGTATGACTATAGTAACTCGTTTATCGTTGATGTTTAATTTGATAAAAGTACTCCA
GAATTGAAAAAGTCTTAAGATTATGTTTAGAAATTAATGAGGGTGTAAGCGAATGTGCTT
GATAATTATAAAGGTAAAGGTCATAAAGTTGTTATTCAAAATCAGCTATTTGATGCTGAT
ATCCTTCGTAGTTTGAGACACTAAAACATTGGTGTTGTTACCAGATCTCATATAGAAAAT
ATTTAATTTACACCAAAATAATTGAAAATTATTTCTGAAAATAAATTATTCAAAAATTTT
TTCTTTATTTATGAAAGAGAAGTATAGGCAGTTATAACACCATATTCTTTTTCTCATAAA
TACGCATTTATTTCTAATTTTTTAGGTCTTGAAGATACAAAAGATTTAGCAAATCCTAAA
ATGCAACAAATTTATTCTGAAAAAGGAGTTGTACTAGATTACAAGGATATTAATCCTAGA
GATGTTGAAGGAGTTAAGTGGGATTAATTAGTCTTCTTGCGTGTACTCGATGTTATTGTA
AAAAATACCCACTCTTTGTACCAGTACATTAATAACGATTCTAAGATTACAAAGGAGTAA
ATCATAAAAGATCTTAAGAAACAATTTCTATAATCTTACTAAGCTCATAGAGAGCTCTAG
CACAAAATATGTATTGAAAAGATATCAACATCTAAGGATTTTAGGGTTCACTTTTGGGAA
GAAAATTAAGGAGGTAAGAAATAAGAGTGTATAGTGTGCCACACAAAAACTAGAAATTAT
TGTATTCAATGCAGCGAAAAAAAGAAGTAAATTATTGGATTTTGTGGAAACTCTAACTGT
CTGCAAAAGCATAATGAGCTACCTGCTAAATTGCTCAATTAATAATTTTAATCTGTTGAT
GTTGATAAAAAGAAAAATCAATATGATAGGCCATATGAAAGTGCTTCAGAAAGCGGAGGA
GGATTTAAAAGTAAACTCGGATTCCGTCCTTTCGATTCTAATAAAGACTAGAGTTCTTTT
AAATCTTCTTCAATGAAACGACTCGATGGTTATTAGAGCGAGGCCGTCTCAAGTATAAAA
TCGAAAAACTTTTCTATTTACTAGCACGATGATGGATTTAAGTCAGATGCTGGTACATCG
TTTAATATTTTCTCTCACAAAAAGAAGAACAATGAAAGTTAAACGTTTAAAACTATTCAG
TAGTTAGCAAAAGAACATGACAGCTAATTTAATTCTTCTAAAAATATTCGTTCTTATAAT
AATGAAAATAGTTCACTTGCAGATGAAATAATCAACGTTTACCAAAAGAAAAAGACAGCA
AGTTCGAATAACCTTGATAAGAATTCACAAGAAACTCAATTACCTACAAAAGATGCTTCT
AATTAGCTAAGAGAGGAAGATAAAAATTATGCATCTGGAAGTGAAAAAGTTCCTCTTAAA
TTAAGAGATTTTGCTCAATTAAAGTCAAAAGGAAGTTTATCCGATATTGAAGGCCAATCT
AATAATAGAAATTAAGATAACTAAGGTAGAGGGGAAACCAAAAATAACTAAGAGAAAAAA
AAGAGGCAAAGCAAAGTACCATGGTATAACACAGAGATGGAAGAAGAGGAGGATCGTAAA
TTTAAGGAGTAGGATCGCAGAAATGCTTAGCAAATATTATAAAACCCAAAAGTTAGAGAA
ATACTTTTTGAAAGTGATAACACTAAGAGAAGTTTAGCAAAAAAACTTGAAAAAAATTAA
AAAATGGCAATTGAGTCTAAATTATAAGAAAAAGAAAGGAAGACTGATTCCAATAAATAG
CAACAATAGTTTAGCAATACTCATCATTAATCTAAAAAGTAAGTATTTTAATTTGAGCAA
GAAGACCATGAAAATTAAATCGAAAAAGAAAAAAATTCTTTTGGAGGAAAAAATCAGAAT
TTCCCAGAACAAAAAACTAAAAGCGAAGTCCCCAATATTTTGCAATAATCGTAATCATTT
GGCATACAAGCAACTCCAACATTGGGAGATAACTAGACTGCTTCTTTCTCTGCTCAAAAT
CAATTGAAAGATAAAAATAATTTGAAAGAAACAGCTACACATGTAGAAAAGAAAAGATTC
TAATTTGAAGAGGAAGAAGATGATGCTCCAGCAGTTTAAAATAGTATTTTATCTTAAGAA
ATAAAGCAACTATCTAAATCATAATAATCTATTCATAATTCTATTTAAGAAAGTTAAAAT
AATAAAATTTTGAACAACTAGGATTTAGAAAACAGTTTAAAAATAAGCTCTTAATAATCT
TTATCTAAGAAATTAGAAAAAGATAAAAGCAACAATATAATTATTGATACATAATCAAAT
TAATCTTCTGAATCGAAGGGAAAAATTGTTTAAAGCCAACAAAAATTTAAAAGCACATCC
CTTGAAAAATCTGAAAACTCCCTTTAAGGGATCATAAAAATATAGAAAGGTAGTTTTTAG
AATATGGAAGAAGTATAGAATGGCTTGTAAAATATTGAAAAAGATAATCAAAACTAAAAA
CTATTAGAAACATCTAACATTTCATCATAAATGAGCAAATAAGAAATAATAAATCAAGAA
ACTAAGAAGTAAGCTAGAACGATTATAAAAGCTCTCCAATAAACAGGGAACAACTAACTA
ATAAGTAATAAATGA


>TTHERM_00616500(protein)
MIQLLKKRRSQWFFESSQEFTEQEIHVRQEILSKQEQKNMEFWQKCKELKKRPHLFQTEK
KIDLDHYQEKDFDEKDVIVIPISTKKNNLIINLEDSPIRHEDHQLVVLEDINDCIDISQD
NIVPNFQIERANGNLLNIQIEKDNEITSEKMINDTFQAVKDNHEESKVNEDINASQDTTI
FNRTLVQQFINERKQAITENQVAIEENIDKTKEATTETNFNLQTEKQVQIQHQINENQMQ
DISFNQGKAVVSVSSSNNLSENQKIQRPIVIEEDKINEEQNKLDDECQEDQANWIWLPLK
APQQIPISYFADWKFKGQDKVNLEYGKNYDASTIFRMLFTQPLYTHIIQNIYKKFNKRIT
KRNIFKDPIEINSYDIDAYISLLLHSQCLQHPNLINTINKINQDMDHHILEFIQNNFSVG
AKVQDENGCFNEIAKIEQFISMVNQRLKQLVQPKEYLQLLHKTIEGNYFKSNSQYFLDEF
RLYDYSNSFIVDVQFDKSTPELKKSQDYVQKLMRVQANVLDNYKGKGHKVVIQNQLFDAD
ILRSLRHQNIGVVTRSHIENIQFTPKQLKIISENKLFKNFFFIYEREVQAVITPYSFSHK
YAFISNFLGLEDTKDLANPKMQQIYSEKGVVLDYKDINPRDVEGVKWDQLVFLRVLDVIV
KNTHSLYQYINNDSKITKEQIIKDLKKQFLQSYQAHRELQHKICIEKISTSKDFRVHFWE
ENQGGKKQECIVCHTKTRNYCIQCSEKKKQIIGFCGNSNCLQKHNELPAKLLNQQFQSVD
VDKKKNQYDRPYESASESGGGFKSKLGFRPFDSNKDQSSFKSSSMKRLDGYQSEAVSSIK
SKNFSIYQHDDGFKSDAGTSFNIFSHKKKNNESQTFKTIQQLAKEHDSQFNSSKNIRSYN
NENSSLADEIINVYQKKKTASSNNLDKNSQETQLPTKDASNQLREEDKNYASGSEKVPLK
LRDFAQLKSKGSLSDIEGQSNNRNQDNQGRGETKNNQEKKKRQSKVPWYNTEMEEEEDRK
FKEQDRRNAQQILQNPKVREILFESDNTKRSLAKKLEKNQKMAIESKLQEKERKTDSNKQ
QQQFSNTHHQSKKQVFQFEQEDHENQIEKEKNSFGGKNQNFPEQKTKSEVPNILQQSQSF
GIQATPTLGDNQTASFSAQNQLKDKNNLKETATHVEKKRFQFEEEEDDAPAVQNSILSQE
IKQLSKSQQSIHNSIQESQNNKILNNQDLENSLKISSQQSLSKKLEKDKSNNIIIDTQSN
QSSESKGKIVQSQQKFKSTSLEKSENSLQGIIKIQKGSFQNMEEVQNGLQNIEKDNQNQK
LLETSNISSQMSKQEIINQETKKQARTIIKALQQTGNNQLISNK


>TTHERM_00616500(gene)
ATTAAAAAATAAACAATTAATATAGAAATCCCTGATTGGAATATAGTCAGAATGATATAG
CTTTTAAAGAAAAGAAGAAGTTAATGGTTTTTTGAAAGCAGCTAAGAGTTTACTGAGCAG
GAAATTCATGTTAGATAAGAAATTCTCTCTAAACAAGAATAAAAGAACATGGAATTTTGG
TAGAAATGCAAAGAACTTAAAAAAAGGCCTCACCTTTTTTAAACAGAAAAAAAAATAGAC
TTAGATCACTACTAAGAAAAAGATTTTGATGAGAAAGATGTCATAGTTATCCCAATATCA
ACAAAGAAGAACAATTTAATAATCAATTTAGAAGACTCTCCAATAAGGCATGAGGATCAC
CAACTAGTAGTTTTAGAGGACATTAATGATTGTATAGATATCAGCCAAGATAATATAGTA
CCGAACTTCTAAATTGAAAGAGCTAATGGAAATTTATTGAATATATAAATTGAAAAAGAC
AACGAAATTACAAGTGAAAAAATGATCAATGACACATTTTAAGCTGTCAAAGATAATCAT
GAAGAGTCGAAAGTAAATGAAGATATTAATGCTAGTTAAGACACTACTATATTCAACAGA
ACACTTGTCTAATAATTCATTAATGAGAGAAAGTAAGCCATTACCGAAAATTAGGTAGCT
ATAGAAGGTAATTTATATTTTAATTACTAAAATTACTATAATTAAACTTGTTTTATTTTT
ATTAGAAAATATCGACAAGACAAAAGAAGCAACTACTGAAACAAATTTTAACCTTTAAAC
AGAAAAATAAGTTCAAATATAACATCAAATCAATGAAAACTAGATGTAGGATATTTCATT
TAATTAAGGTAAAGCAGTTGTTAGCGTTTCATCAAGTAATAATCTATCTGAAAATTAAAG
TAATTGTTTATTTATTTTAAGTTTTTAAATTTAAATAAAATCTCTTTGAATGCATTAAAA
AGAAATTTAAAGACCAATTGTAATAGAAGAAGATAAGATTAATGAGGAGTAGAATAAATT
GGATGATGAATGTTAAGAAGATTAAGCCAACTGGATCTGGCTTCCTTTGAAGGCTCCATA
ATAAATTCCTATATCTTACTTTGCCGATTGGAAATTTAAAGGTTAGGATAAAGTTAATTT
GGAGTATGGAAAAAATTATGATGCCTCTACTATATTTAGGATGCTATTTACTCAGCCTTT
ATACACTCACATTATTTAAAATATTTACAAAAAATTTAACAAGAGAATAACTAAGAGAAA
TATTTTCAAAGATCCAATTGAAATAAACTCTTATGACATAGATGCATACATATCACTTTT
ACTCCATTCTCAATGTTTACAGCATCCTAACTTAATCAGTATTTCTTTTCAAATTATTTA
AAATAAATTAATTTATTTTATTTCAAGTGTGCTTTTGAAAACGAAATTCAATGATTTTTT
TTTTTGAAATTTTTCCCAATTATTTTAGGATTTTTATTAATTATATTATTATTTATAGAT
ACCATAAATAAGATAAATTAAGACATGGATCATCACATTTTAGAGTTTATTTAAAATAAC
TTCTCAGTAGGAGCTAAAGTTTAAGATGAAAATGGCTGTTTTAATGAAATTGCAAAGATT
GAATAGTTTATTTCTATGGTTAACTAAAGGTTAAAGTAACTAGTTTAACCAAAAGAGTAT
CTATAATTGTTACATAAAACTATAGAAGGTAACTATTTTAAAAGCAACTCTCAATATTTT
TTGGATGAATTCAGATTGTATGACTATAGTAACTCGTTTATCGTTGATGTTTAATTTGAT
AAAAGTACTCCAGAATTGAAAAAGTCTTAAGATTATGTTTAGAAATTAATGAGGGTGTAA
GCGAATGTGCTTGATAATTATAAAGGTAAAGGTCATAAAGTTGTTATTCAAAATCAGCTA
TTTGATGCTGATATCCTTCGTAGTTTGAGACACTAAAACATTGGTGTTGTTACCAGATCT
CATATAGAAAATATTTAATTTACACCAAAATAATTGAAAATTATTTCTGAAAATAAATTA
TTCAAAAATTTTTTCTTTATTTATGAAAGAGAAGTATAGGCAGTTATAACACCATATTCT
TTTTCTCATAAATACGCATTTATTTCTAATTTTTTAGGTCTTGAAGATACAAAAGATTTA
GCAAATCCTAAAATGGTATTCTATTTTTTCTTTATTGATATTTTTTTTTAATTCTAAAAT
TATTTTTTGCTTTTTTATTGAAAATTATTTATTTATCATCAAAAAAGCAACAAATTTATT
CTGAAAAAGGAGTTGTACTAGATTACAAGGATATTAATCCTAGAGATGTTGAAGGAGTTA
AGTGGGATTAATTAGTCTTCTTGCGTGTACTCGATGTTATTGTAAAAAATACCCACTCTT
TGTACCAGTACATTAATAACGATTCTAAGATTACAAAGGAGTAAATCATAAAAGATCTTA
AGAAACAATTTCTATAATCTTACTAAGCTCATAGAGAGCTCTAGCACAAAATATGTATTG
AAAAGATATCAACATCTAAGGATTTTAGGGTTCACTTTTGGGAAGAAAATTAAGGAGGTA
AGAAATAAGAGTGTATAGTGTGCCACACAAAAACTAGAAATTATTGTATTCAATGCAGCG
AAAAAAAGAAGTAAATTATTGGATTTTGTGGAAACTCTAACTGTCTGCAAAAGCATAATG
AGCTACCTGCTAAATTGCTCAATTAATAATTTTAATCTGTTGATGTTGATAAAAAGAAAA
ATCAATATGATAGGCCATATGAAAGTGCTTCAGAAAGCGGAGGAGGATTTAAAAGTAAAC
TCGGATTCCGTCCTTTCGATTCTAATAAAGACTAGAGTTCTTTTAAATCTTCTTCAATGA
AACGACTCGATGGTTATTAGAGCGGTATACATTTTTTTCTAAAACATAAAGTTAAATTTA
ATTTTTATAAACAAATTTATAGAGGCCGTCTCAAGTATAAAATCGAAAAACTTTTCTATT
TACTAGCACGATGATGGATTTAAGTCAGGTAATTTATTTAATGAGTTTGGAAGCATACCT
TATTTAATATCAATAATAAATAAATATTCTTAGATGCTGGTACATCGTTTAATATTTTCT
CTCACAAAAAGAAGAACAATGAAAGTTAAACGTTTAAAACTATTCAGTAGTTAGCAAAAG
AACATGACAGCTAATTTAATTCTTCTAAAAATATTCGTTCTTATAATAATGAAAATAGTT
CACTTGCAGATGAAATAATCAACGTTTACCAAAAGAAAAAGACAGCAAGTTCGAATAACC
TTGATAAGAATTCACAAGAAACTCAATTACCTACAAAAGATGCTTCTAATTAGCTAAGAG
AGGAAGATAAAAATTATGCATCTGGAAGTGAAAAAGTTCCTCTTAAATTAAGAGATTTTG
CTCAATTAAAGTCAAAAGGAAGTTTATCCGATATTGAAGGCCAATCTAATAATAGAAATT
AAGATAACTAAGGTAGAGGGGAAACCAAAAATAACTAAGAGAAAAAAAAGAGGCAAAGCA
AAGTACCATGGTATAACACAGAGATGGAAGAAGAGGAGGATCGTAAATTTAAGGAGTAGG
ATCGCAGAAATGCTTAGCAAATATTATAAAACCCAAAAGTTAGAGAAATACTTTTTGAAA
GTGATAACACTAAGAGAAGTTTAGCAAAAAAACTTGAAAAAAATTAAAAAATGGCAATTG
AGTCTAAATTATAAGAAAAAGAAAGGAAGACTGATTCCAATAAATAGCAACAATAGTTTA
GCAATACTCATCATTAATCTAAAAAGTAAGTATTTTAATTTGAGCAAGAAGACCATGAAA
ATTAAATCGAAAAAGAAAAAAATTCTTTTGGAGGAAAAAATCAGAATTTCCCAGAACAAA
GTAAAAAATAATTTCATTTTTTAAAAAAAAATTATTTTCATCTTCAAAAATTTTTAATTG
TAAAAGAAACTAAAAGCGAAGTCCCCAATATTTTGCAATAATCGTAATCATTTGGCATAC
AAGCAACTCCAACATTGGGAGATAACTAGACTGCTTCTTTCTCTGCTCAAAATCAATTGA
AAGATAAAAATAATTTGAAAGAAACAGCTACACATGTAGAAAAGAAAAGATTCTAATTTG
AAGAGGAAGAAGATGATGCTCCAGCAGTTTAAAATAGTATTTTATCTTAAGAAATAAAGC
AACTATCTAAATCATAATAATCTATTCATAATTCTATTTAAGAAAGTTAAAATAATAAAA
TTTTGAACAACTAGGATTTAGAAAACAGTTTAAAAATAAGCTCTTAATAATCTTTATCTA
AGAAATTAGAAAAAGATAAAAGCAACAATATAATTATTGATACATAATCAAATTAATCTT
CTGAATCGAAGGGAAAAATTGTTTAAAGCCAACAAAAATTTAAAAGCACATCCCTTGAAA
AATCTGAAAACTCCCTTTAAGGGATCATAAAAATATAGAAAGGTAGTTTTTAGAATATGG
AAGAAGTATAGAATGGCTTGTAAAATATTGAAAAAGATAATCAAAACTAAAAACTATTAG
AAACATCTAACATTTCATCATAAATGAGCAAATAAGAAATAATAAATCAAGAAACTAAGA
AGTAAGCTAGAACGATTATAAAAGCTCTCCAATAAACAGGGAACAACTAACTAATAAGTA
ATAAATGA