Identifiers and Description

Gene Model Identifier

TTHERM_01107220

Standard Name

TPB2 (Tetrahymena PiggyBac transposase 2)

Aliases

PreTt28071 | 237.m00028 | 3794.m00164

Description

PiggyBac transposase, tpb2p; produces double-strand breaks with four-base 5' protruding ends on DNA; involved in DNA cleavage step of programmed DNA deletion

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01107220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20298.14.0002634815779907e-110hypothetical protein (509 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:24348275: Vogt A, Mochizuki K (2013) A domesticated PiggyBac transposase interacts with heterochromatin and catalyzes reproducible DNA elimination in Tetrahymena. PLoS genetics 9(12):e1004032
  2. Ref:23935529: Vogt A, Goldman AD, Mochizuki K, Landweber LF (2013) Transposon domestication versus mutualism in ciliate genome rearrangements. PLoS genetics 9(8):e1003659
  3. Ref:20357003: Cheng CY, Vogt A, Mochizuki K, Yao MC (2010) A domesticated piggyBac transposase plays key roles in heterochromatin dynamics and DNA cleavage during programmed DNA deletion in Tetrahymena thermophila. Molecular biology of the cell 21(10):1753-62

Sequences

>TTHERM_01107220(coding)
ATGAAAAGAGATATTAACACGCCTATTGATAAAATGAAATTTTACTAGCCTTTAGATAAA
GAAGGCTAGCCTGTTGTAATGTATGACGATGGTACTATAAAAAAATTAGGACAAAAAAGA
ACTTATGAAGGTTAACCTGAATAGTATATCGTTAAAACAAAAAAGAACGATGTTTACTTA
GTTGAAAAATCAAAGAAAGTTAGAAAAGCTAGAAAAAGAAAATAATTTTAAGAAGGAGAA
GATGCTAAGAAACCTTTAACAGAAAAAGAAGTGGAAAAGAGATGGACTGAATTCTCTAAA
GAAAATAAAATGAGACAATAACATAAAGAAGATGATTTGATTGATGATCAATGGAGAAGA
ATATATTCTGTAGATTAAGTTCCAAAAAGCTTTTATATGAAAACTAAATTTGATAAAGAT
TTGAATAGAGATTTTATTCCATATAATGTACCTCATTCCCCATATCATCTGTTCAGAATG
TTTTTTGACGATAGAATATATAAATTGATTATTGAAGAAACTAACCGATATAAACATCAG
AAATATTAAGAGGCCTTACTAAATCTACCTCCTGATAAAACTCTTCCCAAAGAGGCTATG
GACATAGATTCTATAGATTTAGATGCATATCTTTCAATTTTGATATTTATGGGTGTGTAA
AGAATGAAAAGTGTTAAAGACTATTGGAAGAGGAAAAATTATATTAATAGTGAAATAGCG
TGCATAATGAAGTATTCTAGATTTGAATAAATAGACAAACATTTACATTTAGCAGATAAT
GAAGACCCTAAAATCAGAAGTGATCCTATTGGAAAAGTTAGATAATATATGGATTATTTA
AATGAAAATTTTAAGAAATACTATTACCCAGGAGAGTTCCTAGCTATTGATGAAGGTATG
ATACCTTTTAATGGCAAAGTCGCTTTCAAGGTCTATAATCCTGATAAACCCGATAAGTTT
GGTATCAAAGAATATGTTTGTTGTGATTCTTAAAACGCTTACACTTTAGAATCTTAGCTC
TATTATGGTAACCATGAAAATGAAGAATTCCCAGAAATTACTCTTTCCAAAACTAATGAA
GTTGTAATGAATTTACTAAAAGACTATGAAGGCAGATTTCATAAAGTAGTAATGGATAAT
TATTATAACAGTCCAACTTTGTTTTATCTGATGAAATAAAAATCTTTTGGTGCTCTAGGT
ACCATGAGAATCGGGCGTCTAAAATTACCTCCTTATTTACTCTCTTAAATTATGGAAGTC
CATCAAAATAAGGTTTTATCTTACATTTAAGGTGATATCAATCTGGCTATTTTCTTCAGA
GGAACAAACGATAAAGAAATTTGCCTAATGTCAAATTTCATAGATTAAAAAAAGGTTAAA
GATGATTTTTGGAGAGTTCTTGCGTACGTTAAAGAAGACAGAGATATTTTCAAAGAGTAA
AATTTATAGAGCGCTTATTATAACAAATACAAAGGAGGTGTTGATAGAAGAAACAGTTAT
CTCGCAGCATATAGAAATTGTAGGAAGAATATTAAATGGTATAGGCCCGTCTTTTATAGA
ATGTTAGATAATGCGATAGTTAATGCATTTATCCTTTATAATTTTAATTTAAGTCCTAAA
TATAAAATTTCACAAAAAGAATTTAGAATATAGCTATTTAAGGAACTTGCTTGCAGATAT
TCTCCATCTAAAAGCCAACACGCAATCAAAGTCCAATAATTTATGAAAGATAAATCTGCT
GAAGTGGATAAAATACCACAATATTTTGAAAAAGCTATGAAACTTCATATTATGAAAAAT
TGTGATTACTCAGCTCATATTCTTGTTAGATCCCGTACTAAAAAAAAATCTTGCATTGAA
TGCAAATAATTAACTTTATTTTCTTGCAGTACATGCTCAAATATGTTTAAGATGAGAATA
CCTCTTTGTTAATCAGGTTTCAACTAATGCTATGATTTCCATGCAAGTAAAACATATGAA
GAGGTTGTTGAAGATATGTTTACTAAGAGAAGAAAAGATGGAAGAAAATTAGATATCGAA
ATTAAAAAGAAAAAGAAAAAATTAGTTAAGCTCTCAGATGTTTATGATTCAATATTAAAG
CCAAAATAAAGCAATTAAAATCCAATACAAGTAAAAACTAAACAAATCCTATAAAAATCT
GTTACTATTGATCACTACACAAGCAATAAAGCATTTTTAGAAGATGATATGTATTCAGAA
AACTAACCTAATTCAACTGAATTAAATGATCAGTCTACTCGTATGAAGACAAACTAAATC
ATGAGCTCTTCTAATTCAAATTCAATATAAGGAAGTAAAAAAAAAAAGTTCAAGGTCATT
AAAAAGGAAAAAAATTTAAAAACTCAAAAGACAAAATCTTGTGATGCAATATTTAGCAGT
GAGAAGATAAAAAAGAAATATACTGATGAAATAAATGAATTTTTTGATTCAAAAGCTTCC
ATTAGGTTAACTAATTTCTTTTAAGAGAGCTAACGTCTTTAAAATTTACTGAAAGAATCA
TAAGAAAATCTTTCTAAAAAATTTGTTGTTTTAGATTAGACCAGTGATGAAGACTTTAAA
AATAATAACACAGACGAAGATCTCTAATGGATAAATACAACTTTAGAGAAAATAAATTAA
AAAAAAATAGAACCTAACGAAAAATTATCTCCTGGCCTTGGTATAATAAACAAAAAATAA
GAGGCAGAAGAAGTAATAGAAGTATTATCAAGCAGCTCTACTCTAAACGAAGAAAAAGTA
AGAACTAAATATTAAGAAATTCCTTTTACTTTTGGAAGCATTCTTGAAGTAGAACAAGAA
AAAGAAGAATCAGATGATGAAGTTGCGAAGGAATACAAAAAAGTTTCTAAAAGAATAGAA
GAATTTAATGAAGATTCCATTCATTCAAAATAACAACTAGAGGACAGCAATTTTTTTCCA
TAAAAAGCTGGAGTGATTTTTTACTCGATGAGTGAATTAGATAAAAAAAAAGAATAAGTA
ATAAGTGACTAAAATAAAGAATAGAATTAAATTATAGTTAAGTAAGAACATAGATCTGAC
TAGAAAAAAAAGAATAGCTATCCTCTATAACTTTATGACTGTGAAAATGTCCTGAACAAT
GCCATAGATTTTTCTGATTACTCATTTTCATCTTCTGATGAAGAACAATTTGTTTATAAT
AAAAATAAGAACAAATAACAAGAATTAAATCACGAATCAGATACAAATAATCCCTAACTA
TAATACAAAGGCAAAATAAAAAATAATAAATTTAAAATTGATGAGAGCTTTGATGAAAGC
AATCTTAAAATAGAAAGGCCTTTTGATTTAATTCCATTTACCTTTTAAAATGATGCAATG
TAAACTAGTTAAAATTTTGTAGTCATTGATGATGACAGTGATGTAGAATTTTAAAATATA
AATTCTTAGATAATAAATTAATCAAGCATAATTTCAGAAAGTTAAAAATTGGAATTTGAA
GGATTTATTGATAATCCATAACCAACTAAAAAAAGGATAATCTCTTGCCAAGACATGAAA
AGAAAAATTATTATTAAAAAAAATAAAGAGCCAAAAAATGATAATTAGAATATCATTTAC
ATTAACCATTAACGTTTTAAAATAGTGAAGCTAAAAACTACTATATAAATTGACTCAGAC
TGA


>TTHERM_01107220(protein)
MKRDINTPIDKMKFYQPLDKEGQPVVMYDDGTIKKLGQKRTYEGQPEQYIVKTKKNDVYL
VEKSKKVRKARKRKQFQEGEDAKKPLTEKEVEKRWTEFSKENKMRQQHKEDDLIDDQWRR
IYSVDQVPKSFYMKTKFDKDLNRDFIPYNVPHSPYHLFRMFFDDRIYKLIIEETNRYKHQ
KYQEALLNLPPDKTLPKEAMDIDSIDLDAYLSILIFMGVQRMKSVKDYWKRKNYINSEIA
CIMKYSRFEQIDKHLHLADNEDPKIRSDPIGKVRQYMDYLNENFKKYYYPGEFLAIDEGM
IPFNGKVAFKVYNPDKPDKFGIKEYVCCDSQNAYTLESQLYYGNHENEEFPEITLSKTNE
VVMNLLKDYEGRFHKVVMDNYYNSPTLFYLMKQKSFGALGTMRIGRLKLPPYLLSQIMEV
HQNKVLSYIQGDINLAIFFRGTNDKEICLMSNFIDQKKVKDDFWRVLAYVKEDRDIFKEQ
NLQSAYYNKYKGGVDRRNSYLAAYRNCRKNIKWYRPVFYRMLDNAIVNAFILYNFNLSPK
YKISQKEFRIQLFKELACRYSPSKSQHAIKVQQFMKDKSAEVDKIPQYFEKAMKLHIMKN
CDYSAHILVRSRTKKKSCIECKQLTLFSCSTCSNMFKMRIPLCQSGFNQCYDFHASKTYE
EVVEDMFTKRRKDGRKLDIEIKKKKKKLVKLSDVYDSILKPKQSNQNPIQVKTKQILQKS
VTIDHYTSNKAFLEDDMYSENQPNSTELNDQSTRMKTNQIMSSSNSNSIQGSKKKKFKVI
KKEKNLKTQKTKSCDAIFSSEKIKKKYTDEINEFFDSKASIRLTNFFQESQRLQNLLKES
QENLSKKFVVLDQTSDEDFKNNNTDEDLQWINTTLEKINQKKIEPNEKLSPGLGIINKKQ
EAEEVIEVLSSSSTLNEEKVRTKYQEIPFTFGSILEVEQEKEESDDEVAKEYKKVSKRIE
EFNEDSIHSKQQLEDSNFFPQKAGVIFYSMSELDKKKEQVISDQNKEQNQIIVKQEHRSD
QKKKNSYPLQLYDCENVLNNAIDFSDYSFSSSDEEQFVYNKNKNKQQELNHESDTNNPQL
QYKGKIKNNKFKIDESFDESNLKIERPFDLIPFTFQNDAMQTSQNFVVIDDDSDVEFQNI
NSQIINQSSIISESQKLEFEGFIDNPQPTKKRIISCQDMKRKIIIKKNKEPKNDNQNIIY
INHQRFKIVKLKTTIQIDSD


>TTHERM_01107220(gene)
ATGAAAAGAGATATTAACACGCCTATTGATAAAATGAAATTTTACTAGCCTTTAGATAAA
GAAGGCTAGCCTGTTGTAATGTATGACGATGGTACTATAAAAAAATTAGGACAAAAAAGA
ACTTATGAAGGTAATTCTTAATTTTTAAAAATTAAATTTACTCATATTTATTAAAATATA
GGTTAACCTGAATAGTATATCGTTAAAACAAAAAAGAACGATGTTTACTTAGTTGAAAAA
TCAAAGAAAGTTAGAAAAGCTAGAAAAAGAAAATAATTTTAAGAAGGAGAAGATGCTAAG
AAACCTTTAACAGGTAAAATTTTTTTAGTATGGCAATTTAAATTAAAGTGTACCATTAAC
TATAGAAAAAGAAGTGGAAAAGAGATGGACTGAATTCTCTAAAGAAAATAAAGTAAAAAT
AATTATTAGTAAATTTTAAAGTAAAGCTATTTTATAAATACAGATGAGACAATAACATAA
AGAAGATGATTTGATTGATGATCAATGGAGAAGAATATATTCTGTAGATTAAGTTCCAAA
AAGCTTTTATATGAAAACTAAATTTGATAAAGATTTGAATAGAGTAAACGTTTTTTTTCT
CATTTTAAATTAAAATTTAACTTGACATTTAAATAAATTAGGATTTTATTCCATATAATG
TACCTCATTCCCCATATCATCTGTTCAGAATGTTTTTTGACGATAGAATATATAAATTGA
TTATTGAAGAAACTAACCGATATAAACATCAGAAATATTAAGAGGCCTTACTAAATCTAC
CTCCTGATAAAACTCTTCCCAAAGAGGCTATGGACATAGATTCTATAGATTTAGATGCAT
ATCTTTCAATTTTGATATTTATGGGTGTGTAAAGAATGAAAAGTGTTAAAGGTAAATAAT
TTTTTTATTACTTATTTATGACCTTTCAAAAATTTAATTAGAGACTTTTTAAAAATATTG
TCCATGCTTTTCTGAATAAAAATTTTAATGCAAAATTAGACTATTGGAAGAGGAAAAATT
ATATTAATAGTGAAATAGCGTGCATAATGAAGTATTCTAGATTTGAATAAATAGACAAAC
ATTTACATTTAGCAGATAATGAAGACCCTAAAATCAGAAGTGATCCTATTGGAAAAGTTA
GATAATATATGGATTATTTAAATGAAAATTTTAAGAAATACTATTACCCAGGAGAGTTCC
TAGCTATTGATGAAGGTATGATACCTTTTAATGGCAAAGTCGCTTTCAAGGTCTATAATC
CTGATAAACCCGATAAGGTATACTTTTATCATTTTTATTTATTGTTTTAAAAAATTTTTT
CTAGTTTGGTATCAAAGAATATGTTTGTTGTGATTCTTAAAACGCTTACACTTTAGAATC
TTAGCTCTATTATGGTAACCATGAAAATGAAGAATTCCCAGAAATTACTCTTTCCAAAAC
TAATGAAGGTTTTTTTAGTTTTTTCGAAATCAGTTTTGAAATTAATATTTATTATTAAAA
GTTGTAATGAATTTACTAAAAGACTATGAAGGCAGATTTCATAAAGTAGTAATGGATAAT
TATTATAACAGTCCAACTTTGTTTTATCTGATGAAATAAAAATCTTTTGGTGCTCTAGGT
ACCATGAGAATCGGGCGTCTAAAATTACCTCCTTATTTACTCTCTTAAATTATGGAAGTC
CATCAAAATAAGGTTTTAAATTATTTCTAAGTTGTGTATAAAATAACAAACTTAAAAAAA
TATATAAAAGGTTTTATCTTACATTTAAGGTGATATCAATCTGGCTATTTTCTTCAGAGG
AACAAACGATAAAGAAATTTGCCTAATGTCAAATTTCATAGATTAAAAAAAGGTTAAAGA
TGATGTAAATGTTTTCAAAATTTTCTTTCTCTTACTCATTGATTTTAAAAATAGTTTTGG
AGAGTTCTTGCGTACGTTAAAGAAGACAGAGATATTTTCAAAGAGTAAAATTTATAGGTA
AAAAAATTTTATTAAATGATAATTTTTATTTATTTTAAATCTTATTTTGATTAAATTTAT
CATGAAAAATGCAAATACAACCAAATAAGCTAATAGCTTAAGTTATAAGAAATAAAAATA
GCAATATTATTTTTAAATACCTAAATTTAGAGCGCTTATTATAACAAATACAAAGGAGGT
GTTGATAGAAGAAACAGTTATCTCGCAGCATATAGAAATTGTAGGAAGAATATTAAATGG
TATAGGCCCGTCTTTTATAGAATGTTAGATAATGCGATAGTTAATGCATTTATCCTTTAT
AATTTTAATTTAAGTCCTAAATATAAAATTTCACAAAAAGAATTTAGAATATAGCTATTT
AAGGAACTTGCTTGCAGGTAAAATTTTAATTATAAGAATTTTTTATTAATTTTATATAAA
AACATTAGATATTCTCCATCTAAAAGCCAACACGCAATCAAAGTCCAATAATTTATGAAA
GATAAATCTGCTGAAGTGGATAAAATACCACAATATTTTGAAAAAGCTATGAAACTTCAT
ATTATGAAAAATTGTGATTACTCAGCTCATATTCTTGTTAGATCCCGTACTAAAAAAAAA
TCTTGCATTGAATGCAAATAATTAACTTTATTTTCTTGCAGTACATGCTCAAATATGTTT
AAGATGAGAATACCTCTTTGTTAATCAGGTTTCAACTAAGTAAATTAATAAATATTTAAT
AGTAAATTAAATTACATTCATTAAATTACAGTGCTATGATTTCCATGCAAGTAAAACATA
TGAAGAGGTTGTTGAAGATATGTTTACTAAGAGAAGAAAAGATGGAAGAAAATTAGATAT
CGAAATTAAAAAGAAAAAGAAAAAATTAGTTAAGCTCTCAGATGTTTATGATTCAATATT
AAAGCCAAAATAAAGCAATTAAAATCCAATACAAGTAAAAACTAAACAAATCCTATAAAA
ATCTGTTACTATTGATCACTACACAAGCAATAAAGCATTTTTAGAAGATGATATGTATTC
AGAAAACTAACCTAATTCAACTGAATTAAATGATCAGTCTACTCGTATGAAGACAAACTA
AATCATGAGCTCTTCTAATTCAAATTCAATATAAGGTTATATTTTTCGAAAATTTTTATT
GAAATTTCATAAAATGTTTTATGAACAGGAAGTAAAAAAAAAAAGTTCAAGGTCATTAAA
AAGGAAAAAAATTTAAAAACTCAAAAGACAAAATCTTGTGATGCAATATTTAGCAGTGAG
AAGATAAAAAAGAAATATACTGATGAAATAAATGAATTTTTTGATTCAAAAGCTTCCATT
AGGTTAACTAATTTCTTTTAAGAGAGCTAACGTCTTTAAAATTTACTGAAAGAATCATAA
GAAAATCTTTCTAAAAAATTTGTTGTTTTAGATTAGACCAGTGATGAAGACTTTAAAAAT
AATAACACAGACGAAGATCTCTAATGGATAAATACAACTTTAGAGAAAATAAATTAAAAA
AAAATAGAACCTAACGAAAAATTATCTCCTGGCCTTGGTATAATAAACAAAAAATAAGAG
GCAGAAGAAGTAATAGAAGTATTATCAAGCAGCTCTACTCTAAACGAAGAAAAAGTAAGA
ACTAAATATTAAGAAATTCCTTTTACTTTTGGAAGCATTCTTGAAGTAGAACAAGAAAAA
GAAGAATCAGATGATGAAGTTGCGAAGGAATACAAAAAAGTTTCTAAAAGAATAGAAGAA
TTTAATGAAGATTCCATTCATTCAAAATAACAACTAGAGGACAGCAATTTTTTTCCATAA
AAAGCTGGAGTGATTTTTTACTCGATGAGTGAATTAGATAAAAAAAAAGAATAAGTAATA
AGTGACTAAAATAAAGAATAGAATTAAATTATAGTTAAGTAAGAACATAGATCTGACTAG
AAAAAAAAGAATAGCTATCCTCTATAACTTTATGACTGTGAAAATGTCCTGAACAATGCC
ATAGATTTTTCTGATTACTCATTTTCATCTTCTGATGAAGAACAATTTGTTTATAATAAA
AATAAGGTAAAATACTTTTAAATAAATTGTCAAATAAATATTTTTAATAAAATTTTATAG
AACAAATAACAAGAATTAAATCACGAATCAGATACAAATAATCCCTAACTATAATACAAA
GGCAAAATAAAAAATAATAAATTTAAAATTGATGAGAGCTTTGATGAAAGCAATCTTAAA
ATAGAAAGGCCTTTTGATTTAATTCCATTTACCTTTTAAAATGATGCAATGTAAACTAGT
TAAAATTTTGTAGTCATTGATGATGACAGTGATGTAGAATTTTAAAATATAAATTCTTAG
ATAATAAATTAATCAAGCATAATTTCAGAAAGTTAAAAATTGGAATTTGAAGGATTTATT
GATAATCCATAACCAACTAAAAAAAGGATAATCTCTTGCCAAGACATGAAAAGAAAAATT
ATTATTAAAAAAAATAAAGAGCCAAAAAATGATAATTAGAATATCATTTACATTAACCAT
TAACGTTTTAAAATAGTGAAGCTAAAAACTACTATATAAATTGACTCAGACTGA