Identifiers and Description

Gene Model Identifier

TTHERM_000309879

Standard Name

TPB1 (Tetrahymena piggyBac transposase 1)

Aliases

None

Description

PiggyBac-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_000309879

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11661.19.997093137033517e-262Ku70/Ku80 beta-barrel domain-c
ontaining protein (3177 aa)
OxytrichaContig9679.0.g873.000842737734004e-34Ku C terminal domain like
DictyBaseDDB_G02863031.999598840915195e-17ku80 on chromosome: 4 position
4329334 to 4331844
Stentor CoeruleusSteCoe_287600.000000000013887943864964021
SGDYMR106C0.0000899730839127287YKU80 Subunit of the telomeric
Ku complex (Yku70p-Yku80p), i
nvolved in telomere length mai
ntenance, structure and telome
re position effect; relocates
to sites of double-strand clea
vage to promote nonhomologous
end joining during DSB repair

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28087716: Cheng CY, Young JM, Lin CG, Chao JL, Malik HS, Yao MC (2016) The piggyBac transposon-derived genes TPB1 and TPB6 mediate essential transposon-like excision during the developmental rearrangement of key genes in Tetrahymena thermophila. Genes & development 30(24):2724-2736
  2. Ref:20357003: Cheng CY, Vogt A, Mochizuki K, Yao MC (2010) A domesticated piggyBac transposase plays key roles in heterochromatin dynamics and DNA cleavage during programmed DNA deletion in Tetrahymena thermophila. Molecular biology of the cell 21(10):1753-62

Sequences

>TTHERM_000309879(coding)
ATGAAAAATTTAAGAGAAGATTCAGTAACAGATTGGAAGGATAATTAAAATATAGAATTT
CTTATTAAATTGAAGAACCAAATTTCGAAAAAAAATATTCAATTTCTAACATCAGAAGAA
GCTTTATAGATATCACTCAGGATAAAACCTAAGCAGATTCTCTAGAGACCTAAATATAAT
GGCACATTTTAAATCAGAAATGAATTAACTGCTGATGTAGTAGTTTTTACTAAAACATTG
GAAAAGCATTTATTAAATTTGAAGACCTATTCCAATATAACAGAATGGAATCCAAGTACT
TAAAGATAAATGGTTGAATAATAAATATAATATTATTAGGTAGATGATATATTACTTGAA
AATCCTGTGTAGGACATATCTAAATACTATAAATATGGAAATTAACTTGTTAAAATGAGT
GAATTATTTTTGAATTAAATAAATCTCTTTACACTAAAGGAAATTAAGTTAATTGGATCA
GTTTAAAAGTCGTCGATACCAAGATAATCATTTATGTCTGGCTGTGATATTTTATTTGCT
AAGCAAGATTCAAAACGATCTAGATATATAATTGCAAGTTTAATAAAAGCATGCTTTGAA
GAATAAAGGTATCTTGTAGCTAGATTTGTTCTAAGGTAGAACAGCATTCCAAAGCTAGTA
GTTTTGATTCCACATCTTAAAAAAAACTGTGAGTATTTTTATATCATAGAATTGCCAACT
GTAGAATCTATTAGAGATTATTCCTTTAACAGTCTAATAAGATCTACTCCAGAACAATAA
AAACTTATGAGCTAATTGATAGACGAATTAGATTTAGATTAGGATGAAAAAAACTAAAAT
TAATTTAAGATCGGATCACAACCAAATGAGACCATTGCTAAAATTAATGATCTAATATTG
ATGAGAGGAATGAATGTGAATGAAGAAGAAATTAATAAAAAGTTATTTACAAAAGAATAT
TAACAAACATTTAAATCAGCTAGTTAAAAACTTCTGAGTAATATTAATGAATAATTTAAT
TTAAAAATCATTAATTAGTAATTGTATCATGATAGTTTTAACTAAAAGATTTATTGGAAA
AATTTAATAAGTTAAAAAGATGATAAATTATTTAATGATTTAAAAGATATATTTGGCTCA
ATCGAAAAATAGAATTATAAAGATTTAACAAAAAAAGCATATTAATAAATTGATTTTAGT
ATGCCATAGTCAAAAATTATTTCAATTCTATCTTAACCTCTATTTGATATTAGAGAATTT
TAAGAATATATTCAAATTGTGTAAAATTTAATATACAAAACTATGGATACATTTATAAAA
GGATATACTAGTAATATTATTATTGAACTAATTCTTTTAATCAGAAATAAATCTATCTAG
TTTGAATAATATGAGGCATTTAATTAGTTTTTACTCAAATTTTATGAGAAGTTTCAAAAT
GATTAATTTATTTCAGAGATTGTTAGTAGTGAGATAAACTTAATTTCAACAGAAAACCAT
TAAAATTCAGTCATATTGACTTAAATCGAAGAGGAATTTTTAAGATAAAATCTCTTATAA
AAGGAAATGTCATCACTCAGAGTATCAAGTAAAAATTAAGAGAATATATGCCAAAATTAA
ACTTCTAAGATGAAAAAAATTTTAGTGAATAGCTTAAAAAATAATCAAAATAATGATGAA
GAGATATATTATTCTGATGAATCAGAAACAAATCAAGCAAGAAGGCAAAAAGAAAATGAT
AATTCTCTTCCATAGGATAATCATGAAAATTAATAAAATTTTAATACTTAATAATAAAAG
AAATAAAATAAATAATTAGTTTCATTCACTTAATTAAGCAGCTATAATTCAATTTATTCA
GAATCTGAGACTTCTTAGCATGAAGATTAAATCATTTAAAATAATTAAGATCTAAATTCT
TCTATTGAAGAATCAGGAGAAGAAGAATAAAAATAAGACTTAAAAAGAAACAAAGGAAAT
TTTTCCAAAAAGCTTAATTTAAATGATGTTAATTTTAAACTATGCTCAGATAATAAACTT
TTAAAAGAAACTCTCATAAATATCGACCTCACATATAGAAAACCTTAAGTAAAAAATATA
CCTTTAGAGTCAACTCCAGTTTAAATTTTTCAAAAATTGTGGTCTGATGAAATTTGGAAA
TTAATTACAGATGAGACAAATAAATATTCTAAACAAAGCTTTGATTTAAATTAATACAAT
TTAGACAGTTAAAGTCTAAAAAAATAAAAAATTTGCTTTTTTAGTTAAGACTAAATAAAA
AGATTTATAATTTGTGAGATTCTAATGGGAATATAAAGACTTCCCAGCTTTAGTGACTAT
TTTAGTTCAGACCCATTATTGTCTGGAGGTTTGAACAGGATTTTAGGAAGAGAAAATTAT
TAACTGCTGACTAGATATTTGCATATTTCTGATAATTAAAGTAGAATGGTTCATGTAGAT
GATCATACAAAATTTAAATAGTTTTAATCGATTTTAAATCGAAACTATTAATAATTTTAT
GTTCCTTCAAACTATCTTGCAATAGATGAGGGCATTATACCATTTAAAGGAAAAACAAAA
TTTAAAGTGTATTGTCCCTAAAAGCCTGTTAAATTTGGAATTAAAGAGTATTTATTTTGT
GATTACAGTGGTTACACTCTCAACTTAATAATTCATTCACCTCATGAAAAATAAAATATC
AGAGACATTTATCAACCCTAAACTCTTTAAACTCAAGACATTGTAAATGAGTTGATCAAA
GACTATTAGCCACTTTCTGGAAGTATTTTAATCATGGATAATTATTATAATTCATTAAAT
TTAATACATGATCTTAACTAACAAAATATCGGAGTCCTAGGAACTGTTAGGCCGGATAGA
ATGAATTTTACTGAAGAATAAAAAAAAATGATGAAAATTTAAAATTTTAACAAAGGAGAG
ACAAAATCTTTAACTAAGGATAACATTCATATATTCCTTTGGAGAGATAAAGATAAGCTT
GTTAAAATGATTACTAACTTTTTAGATAATAGAAAAATTGTGAAAAGTATGAAAAAAACA
GGCTAAATTAAGACTATTCCTTTAATGGTTGATATTTACAATAAATATGCCCACTCGGTA
GACAAGAGAAACTAAATATGCTAAAATTATAGAATACACAAAAGATCCTAAAAGTGGTGG
AAATGTGTTTTTTATCGTTTATTAGATACAACACTTTGCAATGCTTACATAATTTATAAG
ATATTAAATGAAGGAAAAAAGAGCCTCTTAACACATAAAGACTTTAGAATTAAAATAGTA
GAAGAGTTAATTCAAAGTTTAAATGAATCAACAGCTCAACTCACTAAATCTTTATCCCAT
AATAGAGGTATTATCTACTCTCTAATCGATATAAATAAAGTTAGAAAGTAAGGTGTACAA
CAAGAAATTATAGCTCATTTTCTAGAAAGGTAAAACTAAGTCGGATTATGCTCACTTTGC
AAACAAGCTACTTTTTTTACCTGTGAATCATGTAATTACGGTAATAAAAAGATTGCCTTA
TGCCCTGTGAATTGTCATAAAGAACATATGAAAAAAGTTTATAATCTTATAGATAAGTGA


>TTHERM_000309879(protein)
MKNLREDSVTDWKDNQNIEFLIKLKNQISKKNIQFLTSEEALQISLRIKPKQILQRPKYN
GTFQIRNELTADVVVFTKTLEKHLLNLKTYSNITEWNPSTQRQMVEQQIQYYQVDDILLE
NPVQDISKYYKYGNQLVKMSELFLNQINLFTLKEIKLIGSVQKSSIPRQSFMSGCDILFA
KQDSKRSRYIIASLIKACFEEQRYLVARFVLRQNSIPKLVVLIPHLKKNCEYFYIIELPT
VESIRDYSFNSLIRSTPEQQKLMSQLIDELDLDQDEKNQNQFKIGSQPNETIAKINDLIL
MRGMNVNEEEINKKLFTKEYQQTFKSASQKLLSNINEQFNLKIINQQLYHDSFNQKIYWK
NLISQKDDKLFNDLKDIFGSIEKQNYKDLTKKAYQQIDFSMPQSKIISILSQPLFDIREF
QEYIQIVQNLIYKTMDTFIKGYTSNIIIELILLIRNKSIQFEQYEAFNQFLLKFYEKFQN
DQFISEIVSSEINLISTENHQNSVILTQIEEEFLRQNLLQKEMSSLRVSSKNQENICQNQ
TSKMKKILVNSLKNNQNNDEEIYYSDESETNQARRQKENDNSLPQDNHENQQNFNTQQQK
KQNKQLVSFTQLSSYNSIYSESETSQHEDQIIQNNQDLNSSIEESGEEEQKQDLKRNKGN
FSKKLNLNDVNFKLCSDNKLLKETLINIDLTYRKPQVKNIPLESTPVQIFQKLWSDEIWK
LITDETNKYSKQSFDLNQYNLDSQSLKKQKICFFSQDQIKRFIICEILMGIQRLPSFSDY
FSSDPLLSGGLNRILGRENYQLLTRYLHISDNQSRMVHVDDHTKFKQFQSILNRNYQQFY
VPSNYLAIDEGIIPFKGKTKFKVYCPQKPVKFGIKEYLFCDYSGYTLNLIIHSPHEKQNI
RDIYQPQTLQTQDIVNELIKDYQPLSGSILIMDNYYNSLNLIHDLNQQNIGVLGTVRPDR
MNFTEEQKKMMKIQNFNKGETKSLTKDNIHIFLWRDKDKLVKMITNFLDNRKIVKSMKKT
GQIKTIPLMVDIYNKYAHSVDKRNQICQNYRIHKRSQKWWKCVFYRLLDTTLCNAYIIYK
ILNEGKKSLLTHKDFRIKIVEELIQSLNESTAQLTKSLSHNRGIIYSLIDINKVRKQGVQ
QEIIAHFLERQNQVGLCSLCKQATFFTCESCNYGNKKIALCPVNCHKEHMKKVYNLIDK


>TTHERM_000309879(gene)
ATGAAAAATTTAAGAGAAGATTCAGTAACAGATTGGAAGGATAATTAAAATATAGAATTT
CTTATTAAATTGAAGAACCAAATTTCGAAAAAAAATATTCAATTTCTAACATCAGAAGAA
GCTTTATAGATATCACTCAGGATAAAACCTAAGCAGATTCTCTAGAGACCTAAATATAAT
GGCACATTTTAAATCAGAAATGAATTAACTGCTGATGTAGTAGTTTTTACTAAAACATTG
GAAAAGCATTTATTAAATTTGAAGACCTATTCCAATATAACAGAATGGAATCCAAGTACT
TAAAGATAAATGGTTGAATAATAAATATAATATTATTAGGTAGATGATATATTACTTGAA
AATCCTGTGTAGGACATATCTAAATACTATAAATATGGTACATTATATATATTGTTGGTA
AATTAATTGTAGTTTAAAACAATTTTTATTATTTAGGAAATTAACTTGTTAAAATGAGTG
AATTATTTTTGAATTAAATAAATCTCTTTACACTAAAGGAAATTAAGTTAATTGGATCAG
TTTAAAAGTCGTCGATACCAAGATAATCATTTATGTCTGGCTGTGATATTTTATTTGCTA
AGCAAGATTCAAAACGATCTAGATATATAATTGCAAGTTTAATAAAAGCATGCTTTGAAG
AATAAAGGTATCTTGTAGCTAGATTTGTTCTAAGGTAGAACAGCATTCCAAAGCTAGTAG
TTTTGATTCCACATCTTAAAAAAAACTGTGAGTATTTTTATATCATAGAATTGCCAACTG
TAGAATCTATTAGAGATTATTCCTTTAACAGTCTAATAAGATCTACTCCAGAACAATAAA
AACTTATGAGCTAATTGATAGACGAATTAGATTTAGATTAGGATGAAAAAAACTAAAATT
AATTTAAGATCGGATCACAACCAAATGAGACCATTGCTAAAATTAATGATCTAATATTGA
TGAGGTTATTATTATCATTATTAATTAATTTAAATTATTTAAAAATTTTTATTTAAATTG
GCTTTAACAAAATTTATTATTTTGAAATTAATTTTGAACAATAAATCATGAATATGATAT
TAAATAATCTATTATTAAATTTTCTATTCAATTTTAATAACACTAAAATTTAGTTTAATA
AGTTTATGCTTTGATAATTAGTTAAATATAAAAATCTTAATTTTGAAATAAGAAGAAATA
TGAGTGATAATTAATTAAATAAAACTTGAATGAATATTCTTTTTTAAATGTTAAAATTTT
AAGTTTAATTTAAATAAATTTAAAATTTACTTATTTTATTTTTATAATTAAAGAGGAATG
AATGTGAATGAAGAAGAAATTAATAAAAAGTTATTTACAAAAGAATATTAACAAACATTT
AAATCAGCTAGTTAAAAACTTCTGAGTAATATTAATGAATAATTTAATTTAAAAATCATT
AATTAGTAATTGTATCATGATAGTTTTAACTAAAAGATTTATTGGAAAAATTTAATAAGT
TAAAAAGATGATAAATTATTTAATGATTTAAAAGATATATTTGGCTCAATCGAAAAATAG
AATTATAAAGATTTAACAAAAAAAGCATATTAATAAATTGATTTTAGTATGCCATAGTCA
AAAATTATTTCAATTCTATCTTAACCTCTATTTGATATTAGAGAATTTTAAGAATATATT
CAAATTGTGTAAAATTTAATATACAAAACTATGGATACATTTATAAAAGGATATACTAGT
AATATTATTATTGAACTAATTCTTTTAATCAGAAATAAATCTATCTAGTTTGAATAATAT
GAGGTAATCTATTATTTTAAATTTGATCAAATTACTTTAAAAATTAATTAAAATAAATTA
TATTTTAAAATTAAATTAAAAATAATCAATTTTATTGATTTTAAATTACTCTTAATTTGT
TTAAATCTAGTTTAATAAAGTAATAGAATCATTACAAAATTTATTTAAAATAAATCATAA
TATTTTAATCATATAAATAGGCATTTAATTAGTTTTTACTCAAATTTTATGAGAAGTTTC
AAAATGATTAATTTATTTCAGAGATTGTTAGTAGTGAGATAAACTTAATTTCAACAGAAA
ACCATTAAAATTCAGTCATATTGACTTAAATCGAAGAGGAATTTTTAAGATAAAATCTCT
TATAAAAGGAAATGTCATCACTCAGAGTATCAAGTAAAAATTAAGAGAATATATGCCAAA
ATTAAACTTCTAAGATGAAAAAAATTTTAGTGAATAGCTTAAAAAATAATCAAAATAATG
ATGAAGAGATATATTATTCTGATGAATCAGAAACAAATCAAGCAAGAAGGCAAAAAGAAA
ATGATAATTCTCTTCCATAGGATAATCATGAAAATTAATAAAATTTTAATACTTAATAAT
AAAAGAAATAAAATAAATAATTAGTTTCATTCACTTAATTAAGCAGCTATAATTCAATTT
ATTCAGAATCTGAGACTTCTTAGCATGAAGATTAAATCATTTAAAATAATTAAGATCTAA
ATTCTTCTATTGAAGAATCAGGAGAAGAAGAATAAAAATAAGACTTAAAAAGAAACAAAG
GAAATTTTTCCAAAAAGCTTAATTTAAATGATGTTAATTTTAAACTATGCTCAGATAATA
AACTTTTAAAAGAAACTCTCATAAATATCGACCTCACATATAGAAAACCTTAAGTATTCA
TTAAATGATTTATATAAATTTAAATAATAATTTTATCTTAAAAAATAGGTAAAAAATATA
CCTTTAGAGTCAACTCCAGTTTAAATTTTTCAAAAATTGTGGTCTGATGAAATTTGGAAA
TTAATTACAGATGAGACAAATAAATATTCTAAACAAAGCTTTGATTTAAATTAATACAAT
TTAGACAGTTAAAGTCTAAAAAAATAAAAAATTTGCTTTTTTAGTTAAGACTAAATAAAA
AGATTTATAATTTGTGAGATTCTAATGGGAATATAAAGACTTCCCAGCTTTAGTGACTAT
TTTAGTTCAGACCCATTATTGTCTGGAGGTTTGAACAGGATTTTAGGAAGAGAAAATTAT
TAACTGCTGACTAGATATTTGCATATTTCTGATAATTAAAGTAGAATGGTTCATGTAGAT
GATCATACAAAATTTAAATAGTTTTAATCGATTTTAAATCGAAACTATTAATAATTTTAT
GTTCCTTCAAACTATCTTGCAATAGATGAGGGCATTATACCATTTAAAGGTAATTTATAT
ATTCTTAAATTTTAAAGTCTAAACAATTTCATAAAAAAAGGAAAAACAAAATTTAAAGTG
TATTGTCCCTAAAAGCCTGTTAAATTTGGAATTAAAGAGTATTTATTTTGTGATTACAGT
GGTTACACTCTCAACTTAATAATTCATTCACCTCATGAAAAATAAAATATCAGAGACATT
TATCAACCCTAAACTCTTTAAACTCAAGACATTGTAAATGAGTTGATCAAAGACTATTAG
CCACTTTCTGGAAGTATTTTAATCATGGATAATTATTATAATTCATTAAATTTAATACAT
GATCTTAACTAACAAAATATCGGAGTCCTAGGAACTGTTAGGTAAAATATTTAATTTTTA
TATTATAAATTTAATTCAATAATTAAAATTAACAAATAAATAAATATTTTTTTAGCATAT
AATAATTTTTTGAATTCTATTTTTTCAAAAAAAATAAAATACAACAAAAGGTCAAATGAA
TTTTAAATACTAAACTAAAATTTTTTCAAAAACACTTTTTATTTACAACAAAAATTGATT
TTTTATCTTATTCATAATAAATAATTAAATTAAAGTATCTTTTAGGAAAAAAAGAAGTTT
AAACAAAGAAAAATATTTAAAATACAGACTGGATAATTTCATTTAATTTTATTTTAATGA
TTAAAACTTACAATTTAACTAAGTTAATTTTTACTGAGAAATATTTACTTTTGATTAAAA
ATTAAGAAAAATTAAAATTTATTTTAATTATTTTTTAAATTGAATTTATTCTTTAAAAAT
ATTACTAAAAATTCCTTAAAATTTTTAACTTAAAATGAAATAAAAAAATAAATTCACTTT
GATTTTATATTTATTTAACGACAAATTTAAAATTTAAAAATAAAATAATTTATTTAAAAA
GGCCGGATAGAATGAATTTTACTGAAGAATAAAAAAAAATGATGAAAATTTAAAATTTTA
ACAAAGGAGAGACAAAATCTTTAACTAAGGATAACATTCATATATTCCTTTGGAGAGATA
AAGATAAGCTTGTTAAAATGATTACTAACTTTTTAGATAATAGAAAAATTGTGAAAAGTA
TGAAAAAAACAGGCTAAATTAAGACTATTCCTTTAATGGTAAATAATAAAGTTTTAAATT
ACCATTTAAATACTAAAATATATTAATTAGGTTGATATTTACAATAAATATGCCCACTCG
GTAGACAAGAGAAACTAAATATGCTAAAATTATAGAATACACAAAAGATCCTAAAAGTGG
TGGAAATGTGTTTTTTATCGTTTATTAGATACAACACTTTGCAATGCTTACATAATTTAT
AAGATATTAAATGAAGGAAAAAAGAGCCTCTTAACACATAAAGACTTTAGAATTAAAATA
GTAGAAGAGTTAATTCAAAGTTTAAATGAATCAACAGCTCAACTCACTAAATCTTTATCC
CATAATAGAGGTATTATCTACTCTCTAATCGATATAAATAAAGTTAGAAAGTAAGGTGTA
CAACAAGAAATTATAGCTCATTTTCTAGAAAGGTAAAACTAAGTCGGATTATGCTCACTT
TGCAAACAAGCTACTTTTTTTACCTGTGAATCATGTAATTACGGTAATAAAAAGATTGCC
TTATGCCCTGTGAATTGTCATAAAGAACATATGAAAAAAGTTTATAATCTTATAGATAAG
TGA