Identifiers and Description

Gene Model Identifier

TTHERM_01084370

Standard Name

TPA8 (Tetrahymena P-type ATPase )

Aliases

PreTt05955 | 225.m00058 | 3801.m00235

Description

P-type ATPase; putative sarco(endo)plasmic reticulum Ca(2+) ATPase (SERCA); constitutively expressed; starvation downregulates expression

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • catalytic activity (IEA) | GO:0003824
  • ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism (IEA) | GO:0015662
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
  • ATP binding (IEA) | GO:0005524

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01084370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_174360
WormBaseWBGene000047369.997093137033517e-262locus:sca-1 status:Confirmed
UniProt:Q9XU13 protein_id
:CAB07263.1
Tetrahymena borealisEI9_20487.19.997093137033517e-262calcium-translocating P-type A
TPase, SERCA-type family prote
in (1037 aa)
OxytrichaContig6325.0.0.g289.997093137033517e-262E1-E2 ATPase
SGDYGL167C4.9990774786573115e-144PMR1 High affinity Ca2+/Mn2+ P
-type ATPase required for Ca2+
and Mn2+ transport into Golgi
; involved in Ca2+ dependent p
rotein sorting and processing;
mutations in human homolog AT
P2C1 cause acantholytic skin c
ondition Hailey-Hailey disease
DictyBaseDDB_G02679242.0005330067840427e-93DDB_G0267924 on chromosome: 1
position 1128799 to 1132710

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11952090: Linder JU, Schultz JE (2002) Guanylyl cyclases in unicellular organisms. Molecular and cellular biochemistry 230(1-2):149-58
  2. Ref:10428960: Linder JU, Engel P, Reimer A, Krüger T, Plattner H, Schultz A, Schultz JE (1999) Guanylyl cyclases with the topology of mammalian adenylyl cyclases and an N-terminal P-type ATPase-like domain in Paramecium, Tetrahymena and Plasmodium. The EMBO journal 18(15):4222-32
  3. Ref:9405804: Wang S, Gao D, Penny J, Krishna S, Takeyasu K (1997) P-type ATPases in Tetrahymena. Annals of the New York Academy of Sciences 834( ):158-60
  4. Ref:9124316: Wang S, Takeyasu K (1997) Primary structure and evolution of the ATP-binding domains of the P-type ATPases in Tetrahymena thermophila. The American journal of physiology 272(2 Pt 1):C715-28

Sequences

>TTHERM_01084370(coding)
ATGGCTTAAAGTATTCCATTCTATAACAAAACTGTTAAAGATACTTTGGAGGCTTTAGAG
ACAAACAGTGAGTAAGGTCTCAATTCAACCAAAGCAGCTGCTCTTCTTTCCAAGTATGGT
CATAATGAACTTGAAAAGGAAGAAGGTGAGTCAATCTGGGAAAAGATCAAGGAATAATTC
GAAGACATCCTCGTCAGAATATTATTGCTTGCTGCCTTGATTTCCTTCGTCATTTCATAA
TTCGAGGATAGTCATGAAGATCATGCTGTTCCTGCTTGGGTTGAACCTGCAGTCATTTTC
ACTATTCTTATCTGCAATGCCTTTGTTGGTATTTGGTAAGATCTTGATGCTGAAAAAGCT
ATTTCTGCTTTAAAGGAGTTATAATCACCTCATGCCTTAGTCTTGAGAGACGGAAAGTGG
GTCTAGATCGAAGCTAGAAACCTTGTCCCTGGTGATATTGTCGAAGTTACTCAAGGAGAT
AAAGTCCCTGCAGATTTAAGAATGGTCGAATTAAAGACTATTACCTTGAAGGCTGATTAA
TCTATTTTGACAGGTGAATCCGATCCAGTTAACAAAACTATTTCTCCTATCTCTAAGACT
GAAGCTGGTGTCTTGGACAAAATCAATTACCTCTTTTCTGGTACTTTAATCAACAATGGT
ACTGCTATTGCAGTTGTTGTTTAAACTGGTATGAACACTGAAATCGGTAAAATCTAAAAG
GAAGTTTAAGATGCTGACAAGGAAACTAAAGATGATGACTCTCCCCTTAAGAAGAAAATC
AACGAATTCGGTGACTAACTTGCCAAATACATCTCTTACATCTGTGTCATTTGCTGGGCT
ATGAACATCCCTAACTTCGGAGATGAAGTATTCGGCCACTGGATTAAGGGTGCTATGTAC
TACTTCAAGGTTGCTGTTGCTTTGGCTGTTGCTGCCATTCCTGAAGGTTTACCTGCTGTT
ATTACTACATGTTTGGCTTTAGGTACTAGAAGAATGGCTAAGAAGAAGGCTATCATCAGA
AAGCTTCCCTCTGTCGAAACTTTAGGTTGCACCACTATCATTTGCTCAGATAAGACTGGC
ACTTTAACCACCAATGAAATGAGTGTTGAAAAGTTCTTTGTTGCTGGTAACAAGGATGGT
TCTTAATTAGCTGCCTTCGAAGTTAAGGGTCACTCTTACAGTCCTGAAGGTGAAATTGTT
AACTTCTAAAACTTCAACGGTTCTCAACTCGCTAAAAATATCAAGACCTTTGCCACATCT
ATGGTCTTAAATAATGAATCTAAGCTTATCTTTGACAAGAATAGAGTTAACAGATCTGGT
CTCCCAACTGAAGCTGCTATTAAAGTTCTTTCTGAAAAGATTGGTAAGTACGATCCTGAT
TTCAAAAATAAGTATGTTCCCATTAGCACCGGTCACGTTGAACAATACGGTTCATATCTT
GCTTAAGACTATGAAAAGAGAGCTACTCTTGAATTCTCTCGTGACAGAAAATCTATGTCA
GTTCTCCTCAAATGCAAGTCATCAAACAAAAACGTTCTTTTCATTAAGGGTGCCCCCGAT
TATCTCCTTAAGGCCTCTAAAAAGATTATGAACAAGGATGGAGAAGTCGTTGATTTCACT
GCTGCTACTAAGACTGCCTTTGAAAATTAAATTAAGGAATATGCTAAGGCTGGCTTAAGA
ACTCTTGCCATTTGCGTTAAGTATGACACTGGTGCTTTGGTTGACTACACTGGTCCTTCT
CACCCTGCTCACAAGCAATTAGAAGATTCTAATAACTATGCTAAAATCGAAGAAGATCCT
ATTATCATTGGTGTTGTTGCTGTCAGAGATCCCCCTAGACCTGAAGTTGCTGCCTCTATT
TAAAAGTGTAAACAAGCTGGTATCTCTGTTATCATGATTACTGGTGATATCAAAGAAACT
GCTGAATCAATTGCCCGTGATATTGGTATCATCTAAGCTGGTGATGAAGAATTTAGATCT
CTTACTGGTCACACTTTCGAAAATCTCAGTGAAGAAAAGTAACTTGAATACCTCTAATAA
GTTATTGACGCTCCTTCTGGTTTCGTTTTCTCCAGAACTGATCCCAGACACAAGAGAGCT
CTCGTTAAGATTCTCAGTGGATAAAACCAAATTGTTGCTATGACTGGTGATGGTGTTAAT
GATGCTCCCGCTATCAAGTAAGCTAATATTGGTATTGCTATGGGTATTTCTGGTACTGAA
GTTGCTAAGGAATCATCCGATATGATTTTATCTGATGATAACTTCTCTACAATCGTTGCT
GCTGTCGAAGAAGGTAGAGCCATTTATGCTAACATGAAAGCTTTCATCCGTTACATGATT
TCCTCTAATATTGGTGAAGTTGTTTCAATTTTCCTTTCTTCTCTTCTTGGTATTCCCGAT
GGTTTCAACTCTGTTTAATTACTTTGGGTTAATCTTGTCACTGATGGTCTTCCTGCTACT
GCTCTTTCCTTTAATCCTGCTGATCCTGACTGTATGTTAAAGCCTCCCAGAAGACACGAT
GAACCTCTCATTTCTGGTTTCGTTTTCTTCAGATATCTTATCATTGGTACCTATGTTGGT
GTTTCTACTGTCTTCATCTTCGTCTATTACTACACTGGATACAATTGGGCTGATGATGGT
CATCCTCTTATTGACTTCAAGCATTTAAGAAACTGGGGTGAATGTGCCTAATGGAAAGAT
TTCTCAGTTGCCAGCTTCGGAAAGTACGACTTCTCAAAGCACCCTTGCAATTTCTTCACA
TGGGGTAAATAAAAACCCAGCACCCTTTCTCTCACTACATTGGTAGTTATTGAAATGTTT
AATGCTCTTAATGCTCTTTCTGATGAAGGTTCTTTGCTCTCTATTGGTATCTTCTGTAAC
CCTTACTTAGTTCTTGCCATTATTGGTTCAATGTTACTCCACTGCATGATTCTCTATGTT
GATTTCTTCGAAAATATTTTCAACACTGTTCCACTTACAACTAACGACTGGTTATTGGTT
CTTGCATGCGCATTCCCTGTCGTAATACTTGACGAAATTCTTAAGTTCATTGCAAGATTA
AGAACTCAAGCTGATCTTAAGAGACGTATGGAAGCTCAACATAACCATCATATCAAAACT
GATTGA


>TTHERM_01084370(protein)
MAQSIPFYNKTVKDTLEALETNSEQGLNSTKAAALLSKYGHNELEKEEGESIWEKIKEQF
EDILVRILLLAALISFVISQFEDSHEDHAVPAWVEPAVIFTILICNAFVGIWQDLDAEKA
ISALKELQSPHALVLRDGKWVQIEARNLVPGDIVEVTQGDKVPADLRMVELKTITLKADQ
SILTGESDPVNKTISPISKTEAGVLDKINYLFSGTLINNGTAIAVVVQTGMNTEIGKIQK
EVQDADKETKDDDSPLKKKINEFGDQLAKYISYICVICWAMNIPNFGDEVFGHWIKGAMY
YFKVAVALAVAAIPEGLPAVITTCLALGTRRMAKKKAIIRKLPSVETLGCTTIICSDKTG
TLTTNEMSVEKFFVAGNKDGSQLAAFEVKGHSYSPEGEIVNFQNFNGSQLAKNIKTFATS
MVLNNESKLIFDKNRVNRSGLPTEAAIKVLSEKIGKYDPDFKNKYVPISTGHVEQYGSYL
AQDYEKRATLEFSRDRKSMSVLLKCKSSNKNVLFIKGAPDYLLKASKKIMNKDGEVVDFT
AATKTAFENQIKEYAKAGLRTLAICVKYDTGALVDYTGPSHPAHKQLEDSNNYAKIEEDP
IIIGVVAVRDPPRPEVAASIQKCKQAGISVIMITGDIKETAESIARDIGIIQAGDEEFRS
LTGHTFENLSEEKQLEYLQQVIDAPSGFVFSRTDPRHKRALVKILSGQNQIVAMTGDGVN
DAPAIKQANIGIAMGISGTEVAKESSDMILSDDNFSTIVAAVEEGRAIYANMKAFIRYMI
SSNIGEVVSIFLSSLLGIPDGFNSVQLLWVNLVTDGLPATALSFNPADPDCMLKPPRRHD
EPLISGFVFFRYLIIGTYVGVSTVFIFVYYYTGYNWADDGHPLIDFKHLRNWGECAQWKD
FSVASFGKYDFSKHPCNFFTWGKQKPSTLSLTTLVVIEMFNALNALSDEGSLLSIGIFCN
PYLVLAIIGSMLLHCMILYVDFFENIFNTVPLTTNDWLLVLACAFPVVILDEILKFIARL
RTQADLKRRMEAQHNHHIKTD


>TTHERM_01084370(gene)
ATGGCTTAAAGTATTCCATTCTATAACAAAACTGTTAAAGATACTTTGGAGGCTTTAGAG
ACAAACAGTGAGTAAGGTCTCAATTCAACCAAAGCAGCTGCTCTTCTTTCCAAGTATGGT
CATAATGAACTTGAAAAGGAAGAAGGTGAGTCAATCTGGGAAAAGATCAAGGAATAATTC
GAAGACATCCTCGTCAGAATATTATTGCTTGCTGCCTTGATTTCCTTCGTCATTTCATAA
TTCGGTATTAATTTTTTCTTATGACATTTCTTCTCTTTAAGGATGAGTTCTTCTCGAAAG
AAGATCTCATGGATGGCTCTTTAAGGCCAAACCTATACATCATCTCCAAACTATTTTTAA
AAGAAAATAGTTTGCCTCATTGAAATACATTTTGAATTTAGTGAATTTAAACTCATTATA
CTAATCTAAATTCATTTAATATAATAGAGGATAGTCATGAAGATCATGCTGTTCCTGCTT
GGGTTGAACCTGCAGTCATTTTCACTATTCTTATCTGCAATGCCTTTGTTGGTATTTGGT
AAGATCTTGATGCTGAAAAAGCTATTTCTGCTTTAAAGGAGTTATAATCACCTCATGCCT
TAGTCTTGAGAGACGGAAAGTGGGTCTAGATCGAAGCTAGAAACCTTGTCCCTGGTGATA
TTGTCGAAGTAAGAATTACTTATTTTAATAGTTATTTTAATTGAGCTATTCATTCTAAAA
TCTTTTGTTTGAGTATTGAGTTTTGTTGGTTGATAGATAAGCAAAAAATTTAAAGTAGAG
GAGGATTTAATTTAAATTATAATGTATCAATTAAAAAAACTGATATTGATTGATAGCTCA
ATAGAAATATTAATTTATAATATTTTAAAAAACTTAATTTTATTTCAAAAGGTTACTCAA
GGAGATAAAGTCCCTGCAGATTTAAGAATGGTCGAATTAAAGACTATTACCTTGAAGGCT
GATTAATCTATTTTGACAGGTGAATCCGATCCAGTTAACAAAAGTAATTAAAGATTATAA
TTTACACTCATTTCCTCTATTTATTCTCTTTAAAGTGATTTAAAAAATTGCCAATTATTT
AATTAATTGCTTTTAAAAACAGAAAGAAAATTTATTTCAAAAAAATAAAAGTCAAGCAAA
TTGATTTTTAAATATTAAACAAATAAACATTTTTTATTTAAAAAGACTTTACTTTTTATC
ATTTATTAAGACTCTTTCTTTTGTTTTTATGATGTTTAACTTTATCTTATTTAATTCTAG
CTATTTCTCCTATCTCTAAGACTGAAGCTGGTGTCTTGGACAAAATCAATTACCTCTTTT
CTGGTACTTTAATCAACAATGGTACTGCTATTGCAGTTGTTGTTTAAACTGGTATGAACA
CTGAAATCGGTAAAATCTAAAAGGAAGTTTAAGATGCTGACAAGGAAACTAAAGATGATG
ACTCTCCCCTTAAGAAGAAAATCAACGAATTCGGTGACTAACTTGCCAAATACATCTCTT
ACATGTAAATTAGCTTTACTTTAAATATGAATTTTATGACTATAAAAAAGGATAATTTAA
TTAAAGAATGAAAATTACATTAAGAGATTTAAATATATTACAAATATAAGGTTTCTTATC
AAAATTTACCTAGAGTTAAAAATTAAGCATAGCAAAATTTAACAAGTGTGGTGATAGCAA
AGGAAATTGATTGATTAATCAAATAATTAATTAAATAAATAATTTAATTTCCCCAATTAT
TTATTTATTTAATTATTTAATCAATCAATCAATAATAATAAATGATTAATTTCCAATCAT
TGCAATTTAATAATATATAATTTATCTATCTTTCTTTACATCATCCTCTATCAAAGAAGA
TATTAAAATTTTTAAGCAATATCAAAAGAAAACCTAATAAATACTGAATAATAAGAACCT
AAATAATTAATCCAAGATATATTTAAATATAAACATAAATAGAATATTGTTTTTTAATCG
CTTTATCTAAACATGATTTTTAAATTAATTAAATAGCTGTGTCATTTGCTGGGCTATGAA
CATCCCTAACTTCGGAGATGAAGTATTCGGCCACTGGATTAAGGGTGCTATGTACTACTT
CAAGGTTGCTGTTGCTTTGGCTGTTGCTGCCATTCCTGAAGGTTTACCTGCTGTTATTAC
TACATGTTTGGCTTTAGGTACTAGAAGAATGGCTAAGAAGAAGGCTATCATCAGAAAGCT
TCCCTCTGTCGAAACTTTAGGTTGCACCACTATCATTTGCTCAGATAAGACTGGCACTTT
AACCACCAATGAAATGAGTGTTGAAAAGTTCTTTGTTGCTGGTAACAAGGATGGTTCTTA
ATTAGCTGCCTTCGAAGTTAAGGGTCACTCTTACAGTCCTGAAGGTGAAATTGTTAACTT
CTAAAACTTCAACGGTTCTCAACTCGCTAAAAATATCAAGACCTTTGCCACATCTATGGT
CTTAAATAATGAATCTAAGCTTATCTTTGACAAGAATAGAGTTAACAGATCTGGTCTCCC
AACTGAAGCTGCTATTAAAGTTCTTTCTGAAAAGATTGGTAAGTACGATCCTGATTTCAA
AAATAAGTATGTTCCCATTAGCACCGGTCACGTTGAACAATACGGTTCATATCTTGCTTA
AGACTATGAAAAGAGAGCTACTCTTGAATTCTCTCGTGACAGAAAATCTATGTCAGTTCT
CCTCAAATGCAAGTCATCAAACAAAAACGTTCTTTTCATTAAGGGTGCCCCCGATTATCT
CCTTAAGGCCTCTAAAAAGATTATGAACAAGGATGGAGAAGTCGTTGATTTCACTGCTGC
TACTAAGACTGCCTTTGAAAATTAAATTAAGGAATATGCTAAGGCTGGCTTAAGAACTCT
TGCCATTTGCGTTAAGTATGACACTGGTGCTTTGGTTGACTACACTGGTCCTTCTCACCC
TGCTCACAAGCAATTAGAAGATTCTAATAACTATGCTAAAATCGAAGAAGATCCTATTAT
CATTGGTGTTGTTGCTGTCAGAGATCCCCCTAGACCTGAAGTTGCTGCCTCTATTTAAAA
GTGTAAACAAGCTGGTATCTCTGTTATCATGATTACTGGTGATATCAAAGAAACTGCTGA
ATCAATTGCCCGTGATATTGGTATCATCTAAGCTGGTGATGAAGAATTTAGATCTCTTAC
TGGTCACACTTTCGAAAATCTCAGTGAAGAAAAGTAACTTGAATACCTCTAATAAGTTAT
TGACGCTCCTTCTGGTTTCGTTTTCTCCAGAACTGATCCCAGACACAAGAGAGCTCTCGT
TAAGATTCTCAGTGGATAAAACCAAATTGTTGCTATGACTGGTGATGGTGTTAATGATGC
TCCCGCTATCAAGTAAGCTAATATTGGTATTGCTATGGGTATTTCTGGTACTGAAGTTGC
TAAGGAATCATCCGATATGATTTTATCTGATGATAACTTCTCTACAATCGTTGCTGCTGT
CGAAGAAGGTAGAGCCATTTATGCTAACATGAAAGCTTTCATCCGTTACATGATTTCCTC
TAATATTGGTGAAGTTGTTTCAATTTTCCTTTCTTCTCTTCTTGGTATTCCCGATGGTTT
CAACTCTGTTTAATTACTTTGGGTTAATCTTGTCACTGATGGTCTTCCTGCTACTGCTCT
TTCGTAACTACTTAAAATTTACAAACATTTTATTTAATAATACTTTTTTAAATTATAGCT
TTAATCCTGCTGATCCTGACTGTATGTTAAAGCCTCCCAGAAGACACGATGAACCTCTCA
TTTCTGGTTTCGTTTTCTTCAGATATCTTATCATTGGTACCTATGTTGGTGTTTCTACTG
TCTTCATCTTCGTCTATTACTACACTGGATACAATGTAATTAACATATTAATAATATTTT
CAATTATTTCTTTTTGTGTTGCAAAATTTTTAATGTCCAAGAAAAGAAAAGAATACAATA
GAAATTTCAAATGTATGAATGAAAAATAACTTTTTATTTTAATAAATTAGTGGGCTGATG
ATGGTCATCCTCTTATTGACTTCAAGCATTTAAGAAACTGGGGTGAATGTGCCTAATGGA
AAGATTTCTCAGTTGCCAGCTTCGGAAAGTACGACTTCTCAAAGCACCCTTGCAATTTCT
TCACATGGGGTAAATAAAAACCCAGCACCCTTTCTCTCACTACATTGGTAGTTATTGAAA
TGTTTAATGCTCTTAATGCTCTTTCTGATGAAGGTTCTTTGCTCTCTATTGGTATCTTCT
GTAACCCTTACTTAGTTCTTGCCATTATTGGTTCAATGTTACTCCACTGCATGATTCTCT
ATGTTGATTTCTTCGAAAATATTTTCAACACTGTTCCACTTACAACTAACGACTGGTTAT
TGGTTCTTGCATGCGCATTCCCTGTCGTAATACTTGACGAAATTCTTAAGTTCATTGCAA
GATTAAGAACTCAAGCTGATCTTAAGAGACGTATGGAAGCTCAACATAACCATCATATCA
AAACTGATTGA