Identifiers and Description

Gene Model Identifier

TTHERM_00420880

Standard Name

TPA7 (Tetrahymena P-type ATPase)

Aliases

PreTt07213 | 46.m00268 | 3679.m00118

Description

P-type ATPase; putative Na(+)/K(+) or H(+)/K(+) ATPase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
  • ATP binding (IEA) | GO:0005524
  • catalytic activity (IEA) | GO:0003824
  • ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism (IEA) | GO:0015662
  • ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism (ISS) | GO:0015662 | Ref:9124316

Biological Process

Domains

  • ( PF00122 ) E1-E2 ATPase
  • ( TIGR01487 ) SPP-like hydrolase, Archaeal
  • ( PF07670 ) transporter gate domain protein
  • ( TIGR01497 ) K+-transporting ATPase, B subunit
  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( PF01773 ) Na+ dependent nucleoside transporter
  • ( PF08282 ) haloacid dehalogenase-like hydrolase
  • ( TIGR01511 ) copper-translocating P-type ATPase
  • ( PF00690 ) Cation transporter/ATPase, N-terminus
  • ( TIGR01512 ) cadmium-translocating P-type ATPase
  • ( PF00689 ) Cation transporting ATPase, C-terminus
  • ( PF01957 ) Nodulation efficiency protein D (NfeD)
  • ( PF08113 ) Cytochrome c oxidase subunit IIa
  • ( TIGR01524 ) magnesium-translocating P-type ATPase
  • ( TIGR01482 ) Sucrose-phosphate phosphatase subfamily
  • ( TIGR01525 ) heavy metal translocating P-type ATPase
  • ( TIGR01484 ) HAD-superfamily hydrolase, subfamily IIB
  • ( TIGR01647 ) plasma-membrane proton-efflux P-type ATPase
  • ( TIGR01522 ) calcium-transporting P-type ATPase, PMR1-type
  • ( TIGR01106 ) Na,H/K antiporter P-type ATPase, alpha
  • ( TIGR01517 ) calcium-translocating P-type ATPase, PMCA-type
  • ( TIGR01116 ) calcium-translocating P-type ATPase, SERCA-type
  • ( TIGR01523 ) potassium/sodium efflux P-type ATPase, fungal-type
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01657 ) P-type ATPase of unknown pump
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,
  • ( PF03720 ) UDP-glucose/GDP-mannose dehydrogenase family, UDP binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.1%

TetraMine Data

TTHERM_00420880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_244780
WormBaseWBGene000011379.997093137033517e-262locus:eat-6 status:Confirmed
UniProt:P90735 protein_id
:CAB02694.1
Tetrahymena borealisEI9_10988.19.997093137033517e-262Na,H/K antiporter P-type ATPas
e, alpha subunit protein (1193
aa)
DictyBaseDDB_G02772699.997093137033517e-262ionA on chromosome: 2 position
7864423 to 7868216
OxytrichaContig21999.0.g1289.997093137033517e-262E1-E2 ATPase
SGDYGL167C1.0003602942354155e-110PMR1 High affinity Ca2+/Mn2+ P
-type ATPase required for Ca2+
and Mn2+ transport into Golgi
; involved in Ca2+ dependent p
rotein sorting and processing;
mutations in human homolog AT
P2C1 cause acantholytic skin c
ondition Hailey-Hailey disease

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11952090: Linder JU, Schultz JE (2002) Guanylyl cyclases in unicellular organisms. Molecular and cellular biochemistry 230(1-2):149-58
  2. Ref:10428960: Linder JU, Engel P, Reimer A, Krüger T, Plattner H, Schultz A, Schultz JE (1999) Guanylyl cyclases with the topology of mammalian adenylyl cyclases and an N-terminal P-type ATPase-like domain in Paramecium, Tetrahymena and Plasmodium. The EMBO journal 18(15):4222-32
  3. Ref:9405804: Wang S, Gao D, Penny J, Krishna S, Takeyasu K (1997) P-type ATPases in Tetrahymena. Annals of the New York Academy of Sciences 834( ):158-60
  4. Ref:9124316: Wang S, Takeyasu K (1997) Primary structure and evolution of the ATP-binding domains of the P-type ATPases in Tetrahymena thermophila. The American journal of physiology 272(2 Pt 1):C715-28

Sequences

>TTHERM_00420880(coding)
ATGTAATAACATATAAACGATATCGATAATCGTAGACGTGTTTCATCTATAGCTTTGCAC
TTTGAAGAGCTGAGATAAACAGTGACATTAAATAATGCTGTCAGAGAAAGAAAATAAACT
TAGCACCTTCACAACTACAGCTAAAAATAGTAACATTATGAAAACAAGATACCCCACTCA
AATAAATATACTATGGAATATGAGGATCTAGAGACTTAAGATACAAGTTTAATAGAGCAA
GTTTAACAAAACCATTAAAACCATGACGAAATGGTTGAATAAGCTGCAAACTAAATCTAA
GCTAAAGTAGATCATAAAATTGCTTTAGATAAGCTTTACAAAAAGTATTAAACTAGTTCT
TAAAAGGGTTTAACAACAGACCAAGCAAGTAAGTTACTCGAGGAACACGGTGAAAATAAA
TTAACTGAAAAAGATAAAACACCATGGTGGGTTTTACTTCTCAAGGAATTAACTAATGGG
TTTGCTATTATGCTTTGGCTGGGTGGTATTTTGTGTTTTATTACTTATGGCTTAAATTCT
TCAGATCCCTCTAATCTTTATTTAGGTATTGTTATCATAATTGTTATCAGTATTACAGCT
GTTATAACTTTTTAATAAAATGCTAAATCTGAAGCTATTATGGAATCTTTTAAAAATTTT
ATTCCTCAAAACTCTACTGTAATTAGAGATGGTAGTATCAAAAATATTTCTGCAGTGACT
TTAGTTGTTGGTGACATAGTATTAGTAAAAGCTGGTGAAAAAATTCCTGCAGATATTCGT
ATTATTGAATCTAACGAAATGAAAGTAGATAATTCTCCTCTAACAGGTGAGTGTGAACCA
CTTCTTCGTACAGTAGAATGCTCTCATCCAGATAGCTATCTTGAAACTTCTAACCTTGCA
TTCTTTGGAACTCTTTGCAAAGAAGGAACAGGAAAGGGAATCGTTATTTGTACTGGTGAT
AGAACAACACTTGGATAAATTGCGGATCTAACCTCTAGTGATAAAAAGGCTAAAACTCCT
TTGAGAATCGAGCTAGATCGTTTCGTTTTAATGATTACTATTATTGCAATTTTTCTTGGT
GTTCTATTCTTTTTCTTAGCTTTTTTTGTTATGAATTATGATTCTCTTACATGTATTATT
TTTGGTATTGGTATTCTAGTTGCTAACGTCCCAGAAGGCTTACTTGGCTGTATTACAGTC
TCTCTAGCTATTACAGCTAAGAATCTCTCTAAAAAGTAGGTATTAGTAAAAAATCTAGAA
GCAGTAGAAACCTTAGGGTCAACTACATGTATTTGCTCAGACAAAACAGGTACTCTTACT
CAAAATGTTATGTCTGTGAAGCATATGTGGTACAATAATAGAATTCATATAGCTCAGAAC
TAAAAATTGCTAAATGGAAATAAGGCTGATTATGATATGAATGATCCTAACTTTATGATG
CTTCATTAATCTGCTATGATTTGCAGCGAAGCTCGTTTCGACACATCTAGCTTACCCGAT
TAAACAGATATAGATTATTTAACATGCCCAGTAATTGGGGATGCAACTGAAACAGGCTTA
ATTCGCTTCTATTAATATATTTCCGATGTCAACAAATTCCGTGATAGATTCAAAGTAGTT
CGTAATCCTGATGGTACTTAAGCTAAAATGCCTTTCAATTCTTCAGTGAAATTTGCATTA
ACAATAGTTGAAGAAAAAACATAAAATAGTAATTATTGTGTATATATTAAAGGAGCTCCT
GAGAAAATATGGGCTTATTGCTCTTCTGTACTTATAGGCTAAAAACCTGATATTATTAAT
TAAAAATGGAAAGATGAATTTAAAAAGGTTAATCTTATTTTTGGTAAGGGAGGCGAAAGA
GTACTCGGATTTGCAAGATTACCTCTTCCTTCTGACTTATATCCTATGGGATCTCATTTT
ACTGTTTCATCAATATCGAAATTCAACTTTAAACTGGAAAACTTTTAATTTTGTGGTTTA
GTTTCCTTAATGGATCCTCCGAAAACTAGAGTTCCAGCTGCTATACTTGAATGCAGATCT
GCTGGTATAAAAGTTATAATGGTTACTGGAGATTAACCTCCAACAGCAGCAGCAATAGCT
AAAGAAGTAAATATTGTACCAAAAGACATTTAAACAAATGAAGATATACTAGAGTAAAAT
CCTGATATTGATTGGTTTGATGCAAGTGAAAAATGTGAAGCAATAGTTGTACATGGAGAC
AGAATAGTAGAGTCTATTGATAGATGCTCGTAAGAAGGGAGAGATGATGAATTATACTAT
CTAAGGAGATGGGTAAATAAACCTTATTGCGTTTTTGCTCGTACTACACCAGCATAAAAA
CTTTAAATAGTGAATGCTTGCTAAAAAGAAGGCTTTATTTGCGCAGTTACTGGTGATGGA
GTTAATGATTCTCCTGCTATTAAATAAGGCGATATCGGAATTTCAATGAATATTTCAGGT
AGTGATGTGACTAAAGATGCTGCTGATATGATTCTTCTTGACGATGATTTTGCTTCTATC
GTTAGTGGAATTGAAGAAGGCAGAAAAATTTTTGATAACCTTAAAAAAACAGTAGTTTAT
CTTTTAACATCAAATATGACTGAAATTGTTCCCTTCTTAGCCTTCATAGTTTGCCAAATT
CCTCTCCCTCTTTCCAGTATATTTATGCTCGTTATATGTGTTGGTACTGATATTTGGCCA
GCTATTTCTCTAGCATATGAAGAAGCCGAATTAGATGTGATGACAAGAAAACCACGTACA
AAGGAAGAACATCTTGTTTCAGCAAAGTTAATAACTATATCTTATCTTATGTTAGGTTAA
ATTGGATCAGCAGGTGGATTTATTGGATATTTTGTGTGCTTTAATTATTTAGGCTTTCCT
GTTAAATCTTTATTTGGTATTGCAAATGCTGAAGGATATAAACCTCCTGTAAATGACTTC
AATACTTATCATAATAATGATCCATATTTTAACTCAGCTTTACATGCTCTCACTTTGGGT
GACTGTAATAAAAATGCTAAAGCTGCTGAAAAGATTAAATACACTATTGACTGGTCAAAT
TTAAATGATGTTAATTATGATCTGAGAAAATCATTACTTAAATGTAATTCTTAAGGTTAG
TGGGTCCCTGCAATTGAATGGAGTCATTGTAATGTCAACTCTTCAAGTTATAAATCAGAT
AGTGTCAAAGTAACTTCTTGTTATTCAATAGATGCTATATACTGGGCATAATCAGTTTAC
TTTGTATCAATTGTAACTATTTAATGGTCAAATATTTTTGCCTGTAAGTCTAGAAAAATG
AGTTTTACAACATCTGCTTTTAACAAAACCATGGTTTAAGGAGTTATTTTTGAGACACTA
ATAGCATTATTCCTTCTCTATGTCCCAGGTGTCTAAGATGTATTTGGAGGAAGATCCCTC
CCATTTTTCTTGTTTGGTATACCAGGAATATGTTTGAGTATAACTCTTCTTGCTTGGGAG
GAGACAAGAAAATATTTAGCTAGAACCTAAAGATGGTTTTTGAAATATGCTTTATGGTGA


>TTHERM_00420880(protein)
MQQHINDIDNRRRVSSIALHFEELRQTVTLNNAVRERKQTQHLHNYSQKQQHYENKIPHS
NKYTMEYEDLETQDTSLIEQVQQNHQNHDEMVEQAANQIQAKVDHKIALDKLYKKYQTSS
QKGLTTDQASKLLEEHGENKLTEKDKTPWWVLLLKELTNGFAIMLWLGGILCFITYGLNS
SDPSNLYLGIVIIIVISITAVITFQQNAKSEAIMESFKNFIPQNSTVIRDGSIKNISAVT
LVVGDIVLVKAGEKIPADIRIIESNEMKVDNSPLTGECEPLLRTVECSHPDSYLETSNLA
FFGTLCKEGTGKGIVICTGDRTTLGQIADLTSSDKKAKTPLRIELDRFVLMITIIAIFLG
VLFFFLAFFVMNYDSLTCIIFGIGILVANVPEGLLGCITVSLAITAKNLSKKQVLVKNLE
AVETLGSTTCICSDKTGTLTQNVMSVKHMWYNNRIHIAQNQKLLNGNKADYDMNDPNFMM
LHQSAMICSEARFDTSSLPDQTDIDYLTCPVIGDATETGLIRFYQYISDVNKFRDRFKVV
RNPDGTQAKMPFNSSVKFALTIVEEKTQNSNYCVYIKGAPEKIWAYCSSVLIGQKPDIIN
QKWKDEFKKVNLIFGKGGERVLGFARLPLPSDLYPMGSHFTVSSISKFNFKLENFQFCGL
VSLMDPPKTRVPAAILECRSAGIKVIMVTGDQPPTAAAIAKEVNIVPKDIQTNEDILEQN
PDIDWFDASEKCEAIVVHGDRIVESIDRCSQEGRDDELYYLRRWVNKPYCVFARTTPAQK
LQIVNACQKEGFICAVTGDGVNDSPAIKQGDIGISMNISGSDVTKDAADMILLDDDFASI
VSGIEEGRKIFDNLKKTVVYLLTSNMTEIVPFLAFIVCQIPLPLSSIFMLVICVGTDIWP
AISLAYEEAELDVMTRKPRTKEEHLVSAKLITISYLMLGQIGSAGGFIGYFVCFNYLGFP
VKSLFGIANAEGYKPPVNDFNTYHNNDPYFNSALHALTLGDCNKNAKAAEKIKYTIDWSN
LNDVNYDLRKSLLKCNSQGQWVPAIEWSHCNVNSSSYKSDSVKVTSCYSIDAIYWAQSVY
FVSIVTIQWSNIFACKSRKMSFTTSAFNKTMVQGVIFETLIALFLLYVPGVQDVFGGRSL
PFFLFGIPGICLSITLLAWEETRKYLARTQRWFLKYALW


>TTHERM_00420880(gene)
ATGTAATAACATATAAACGATATCGATAATCGTAGACGTGTTTCATCTATAGCTTTGCAC
TTTGAAGAGCTGAGATAAACAGTGACATTAAATAATGCTGTCAGAGAAAGAAAATAAACT
TAGCACCTTCACAACTACAGCTAAAAATAGTAACATTATGAAAACAAGATACCCCACTCA
AATAAATATACTATGGAATATGAGGATCTAGAGACTTAAGATACAAGTTTAATAGAGCAA
GTTTAACAAAACCATTAAAACCATGACGAAATGGTTGAATAAGCTGCAAACTAAATCTAA
GCTAAAGTAGATCATAAAATTGCTTTAGATAAGCTTTACAAAAAGTATTAAACTAGTTCT
TAAAAGGGTTTAACAACAGACCAAGCAAGTAAGTTACTCGAGGAACACGGTGAAAATAAA
TTAACTGAAAAAGATAAAACACCATGGTGGGTTTTACTTCTCAAGGAATTAACTAATGGG
TTTGCTATTATGCTTTGGCTGGGTGGTATTTTGTGTTTTATTACTTATGGCTTAAATTCT
TCAGATCCCTCTAATCTTTATTTAGGTATTGTTATCATAATTGTTATCAGTATTACAGCT
GTTATAACTTTTTAATAAAATGCTAAATCTGAAGCTATTATGGAATCTTTTAAAAATTTT
ATTCCTCAAAACTCTACTGTAATTAGAGATGGTAGTATCAAAAATATTTCTGCAGTGACT
TTAGTTGTTGGTGACATAGTATTAGTAAAAGCTGGTGAAAAAATTCCTGCAGATATTCGT
ATTATTGAATCTAACGAAATGAAAGTAGATAATTCTCCTCTAACAGGTGAGTGTGAACCA
CTTCTTCGTACAGTAGAATGCTCTCATCCAGATAGCTATCTTGAAACTTCTAACCTTGCA
TTCTTTGGAACTCTTTGCAAAGAAGGAACAGGAAAGGGAATCGTTATTTGTACTGGTGAT
AGAACAACACTTGGATAAATTGCGGATCTAACCTCTAGTGATAAAAAGGCTAAAACTCCT
TTGAGAATCGAGCTAGATCGTTTCGTTTTAATGATTACTATTATTGCAATTTTTCTTGGT
GTTCTATTCTTTTTCTTAGCTTTTTTTGTTATGAATTATGATTCTCTTACATGTATTATT
TTTGGTATTGGTATTCTAGTTGCTAACGTCCCAGAAGGCTTACTTGGCTGTATTACAGTC
TCTCTAGCTATTACAGCTAAGAATCTCTCTAAAAAGTAGGTATTAGTAAAAAATCTAGAA
GCAGTAGAAACCTTAGGGTCAACTACATGTATTTGCTCAGACAAAACAGGTACTCTTACT
CAAAATGTTATGTCTGTGAAGCATATGTGGTACAATAATAGAATTCATATAGCTCAGAAC
TAAAAATTGCTAAATGGAAATAAGGCTGATTATGATATGAATGATCCTAACTTTATGATG
CTTCATTAATCTGCTATGATTTGCAGCGAAGCTCGTTTCGACACATCTAGCTTACCCGAT
TAAACAGATATAGATTATTTAACATGCCCAGTAATTGGGGATGCAACTGAAACAGGCTTA
ATTCGCTTCTATTAATATATTTCCGATGTCAACAAATTCCGTGATAGATTCAAAGTAGTT
CGTAATCCTGATGGTACTTAAGCTAAAATGCCTTTCAATTCTTCAGTGAAATTTGCATTA
ACAATAGTTGAAGAAAAAACATAAAATAGTAATTATTGTGTATATATTAAAGGAGCTCCT
GAGAAAATATGGGCTTATTGCTCTTCTGTACTTATAGGCTAAAAACCTGATATTATTAAT
TAAAAATGGAAAGATGAATTTAAAAAGGTTAATCTTATTTTTGGTAAGGGAGGCGAAAGA
GTACTCGGATTTGCAAGATTACCTCTTCCTTCTGACTTATATCCTATGGGATCTCATTTT
ACTGTTTCATCAATATCGAAATTCAACTTTAAACTGGAAAACTTTTAATTTTGTGGTTTA
GTTTCCTTAATGGATCCTCCGAAAACTAGAGTTCCAGCTGCTATACTTGAATGCAGATCT
GCTGGTATAAAAGTTATAATGGTTACTGGAGATTAACCTCCAACAGCAGCAGCAATAGCT
AAAGAAGTAAATATTGTACCAAAAGACATTTAAACAAATGAAGATATACTAGAGTAAAAT
CCTGATATTGATTGGTTTGATGCAAGTGAAAAATGTGAAGCAATAGTTGTACATGGAGAC
AGAATAGTAGAGTCTATTGATAGATGCTCGTAAGAAGGGAGAGATGATGAATTATACTAT
CTAAGGAGATGGGTAAATAAACCTTATTGCGTTTTTGCTCGTACTACACCAGCATAAAAA
CTTTAAATAGTGAATGCTTGCTAAAAAGAAGGCTTTATTTGCGCAGTTACTGGTGATGGA
GTTAATGATTCTCCTGCTATTAAATAAGGCGATATCGGAATTTCAATGAATATTTCAGGT
AGTGATGTGACTAAAGATGCTGCTGATATGATTCTTCTTGACGATGATTTTGCTTCTATC
GTTAGTGGAATTGAAGAAGGCAGAAAAATTTTTGATAACCTTAAAAAAACAGTAGTTTAT
CTTTTAACATCAAATATGACTGAAATTGTTCCCTTCTTAGCCTTCATAGTTTGCCAAATT
CCTCTCCCTCTTTCCAGTATATTTATGCTCGTTATATGTGTTGGTACTGATATTTGGCCA
GCTATTTCTCTAGCATATGAAGAAGCCGAATTAGATGTGATGACAAGAAAACCACGTACA
AAGGAAGAACATCTTGTTTCAGCAAAGTTAATAACTATATCTTATCTTATGTTAGGTTAA
ATTGGATCAGCAGGTGGATTTATTGGATATTTTGTGTGCTTTAATTATTTAGGCTTTCCT
GTTAAATCTTTATTTGGTATTGCAAATGCTGAAGGATATAAACCTCCTGTAAATGACTTC
AATACTTATCATAATAATGATCCATATTTTAACTCAGCTTTACATGCTCTCACTTTGGGT
GACTGTAATAAAAATGCTAAAGCTGCTGAAAAGATTAAATACACTATTGACTGGTCAAAT
TTAAATGATGTTAATTATGATCTGAGAAAATCATTACTTAAATGTAATTCTTAAGGTTAG
TGGGTCCCTGCAATTGAATGGAGTCATTGTAATGTCAACTCTTCAAGTTATAAATCAGAT
AGTGTCAAAGTAACTTCTTGTTATTCAATAGATGCTATATACTGGGCATAATCAGTTTAC
TTTGTATCAATTGTAACTATTTAATGGTCAAATATTTTTGCCTGTAAGTCTAGAAAAATG
AGTTTTACAACATCTGCTTTTAACAAAACCATGGTTTAAGGAGTTATTTTTGAGACACTA
ATAGCATTATTCCTTCTCTATGTCCCAGGTGTCTAAGATGTATTTGGAGGAAGATCCCTC
CCATTTTTCTTGTTTGGTATACCAGGAATATGTTTGAGTATAACTCTTCTTGCTTGGGAG
GAGACAAGAAAATATTTAGCTAGAACCTAAAGATGGTTTTTGAAATATGCTTTATGGTGA