Identifiers and Description

Gene Model Identifier

g12922

Standard Name

TPA4 (Tetrahymena P-type ATPase)

Aliases

None

Description

E1-E2 ATPase family protein, P-type ATPase; putative Na(+)/K(+) or H(+)/K(+) ATPase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 296

No
Presense Probability:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 297

0%

TetraMine Data

g12922

WebApollo

A PHP Error was encountered

Severity: Notice

Message: Undefined variable: webapollo

Filename: feature/featureDetailsView.php

Line Number: 338

&tracks=DNA%2CmRNA%2Cgene%2CCDS%2Cexon">Fullscreen View

A PHP Error was encountered

Severity: Notice

Message: Undefined variable: webapollo

Filename: feature/featureDetailsView.php

Line Number: 340

&tracks=DNA%2CmRNA&nav=0&overview=0" width="700px" height="200px" type="text/html">

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11952090: Linder JU, Schultz JE (2002) Guanylyl cyclases in unicellular organisms. Molecular and cellular biochemistry 230(1-2):149-58
  2. Ref:10428960: Linder JU, Engel P, Reimer A, Krüger T, Plattner H, Schultz A, Schultz JE (1999) Guanylyl cyclases with the topology of mammalian adenylyl cyclases and an N-terminal P-type ATPase-like domain in Paramecium, Tetrahymena and Plasmodium. The EMBO journal 18(15):4222-32
  3. Ref:9405804: Wang S, Gao D, Penny J, Krishna S, Takeyasu K (1997) P-type ATPases in Tetrahymena. Annals of the New York Academy of Sciences 834( ):158-60
  4. Ref:9124316: Wang S, Takeyasu K (1997) Primary structure and evolution of the ATP-binding domains of the P-type ATPases in Tetrahymena thermophila. The American journal of physiology 272(2 Pt 1):C715-28

Sequences

>g12922(protein)
MNVVRQSSSGVVRKFEEMRQSIQLKNSIQEIRQSQEFQKPRTELEDGNKHQHINCEIQET
TIKTEGFMISNTQAADVAKNTVNKKLNKDEKQKQDIVEKVDHKISLEELKQKYQTDFQNG
LTEQKAQELLKKYGENKLTVKQGTPLWVKLLKEMTNGFSLMLWVSAILCFIAQGLQPNPS
NIYLAVVLIIVILITTAITFQQNAKSEALMNSFKNFIPAKTIVIRGGEIKQIEAVHLVVG
DIVIIRIGEKIPADIRILESNEMKVDNSPLTGESEPLLRTTECSHPESYIETSNIAFFGT
LCKEGNGKGIVICTGDNTMLGQIADLSSGEKKVKTPLRVELDRFVVLITIIAIVLGVAFF
LLALLYMNYKVTDCLVFGIGILVANVPEGLLGCITISLAITAKNLSAKNVLVKNLEAVET
LGSTSCICSDKTGTLTQNVMSVKNLWYSDQIHLSKNKTHLKQGEIPEYNTEDPDFKTLQK
AAMLSSEARFDTSTIKERDNIDYMTCPVLGDATETGIIRFYQYIEDVNSFRERYRVAKNP
DGTQGKMPFNSQVKFALTIIEEQTQESYYTVYIKGAPEKIWSFCSSIIVNGKPSQLNDNW
QKKFKAVNLTFGKGGERVLGFAKLSLPAAQFPQGFIFNVSSIQKFPFKLANFQFCGLISL
MDPPKQRVPYAILECRSAGVKVIMVTGDQPPTAAAIAKEVNIIPKDILTNEDLMERNPNL
SWWEASEQCRAIIVHGDRITESIDKALSEKKEDCFYLRQWVVKPYCVFARTTPAQKLQIV
DACQKEGFIVAATGDGVNDSPAIKKADIGISMNISGSDVTKDAADMVLVDDDFASIVLGV
EEGRKIFDNLKKTIVYLLTSNMTEIVPFLAFIILQIPLPLSSIYMLVICVGTDVWPAISL
AYEEAELDVMTRRPRNKSEHLVSNKLITIAYLQTGQIASGAGHLGYYIAFNYFGFPVLSL
FGLASATGYRPVKNDFGTYYNPLLQREDPYYNAAIYNITKFQDCNQLSTDQNNALSNLQY
SLDWFTLSEGNYDLRKALVKCDPVTGAFIPWIKWSDCDINESQNWSVLTSQTACYSVEAI
NYAQSVYFLTVVLLQWTNVFACKSRSMSFTTTAFNSVMIQGVIFETILVIFLQYVPGVQT
VFGGRPMFFWLWTSCLAYTMLLLIYDELRKFFCRKNRWFYKYCYW


>g12922(coding)
ATGAATGTTGTTCGACAGTCCTCATCTGGCGTCGTAAGAAAATTTGAAGAAATGAGGTAG
TCCATCTAACTTAAAAATTCCATTCAAGAAATTAGATAAAGTTAGGAATTCTAAAAGCCA
AGAACTGAGTTGGAAGACGGAAACAAGCATTAGCACATTAACTGTGAAATTTAAGAAACA
ACAATTAAAACAGAAGGTTTTATGATTTCTAACACTCAAGCTGCTGATGTAGCTAAAAAT
ACTGTTAACAAAAAATTAAATAAGGATGAAAAATAAAAACAAGATATTGTTGAAAAAGTA
GACCACAAAATTTCTTTGGAGGAACTGAAATAAAAGTATCAAACTGATTTCCAGAATGGT
TTAACTGAACAAAAAGCTTAGGAATTACTAAAAAAGTATGGCGAGAATAAGCTTACTGTT
AAGTAAGGAACTCCATTATGGGTAAAACTCTTGAAAGAAATGACTAATGGCTTTTCACTC
ATGCTTTGGGTTAGTGCTATTCTATGTTTCATTGCTTAAGGATTGCAGCCAAATCCCTCT
AACATTTACCTTGCAGTAGTCCTCATTATTGTCATTTTAATTACCACTGCAATTACTTTC
TAATAAAATGCAAAGAGTGAAGCATTGATGAATTCTTTTAAAAATTTTATCCCTGCAAAG
ACAATAGTTATTAGAGGAGGTGAAATAAAGCAAATAGAAGCTGTACATCTTGTTGTCGGT
GACATAGTTATCATAAGAATAGGTGAAAAAATCCCCGCTGACATTCGTATTCTAGAATCA
AATGAAATGAAAGTAGATAATTCCCCTTTGACTGGTGAAAGTGAACCTCTATTGCGTACT
ACTGAATGCTCCCATCCTGAAAGCTATATTGAAACATCTAATATAGCCTTCTTCGGTACT
CTATGTAAAGAAGGTAACGGAAAGGGAATTGTTATCTGCACTGGTGATAATACTATGCTT
GGTTAGATTGCTGATTTGTCTTCTGGTGAAAAGAAAGTCAAAACTCCTCTCCGTGTTGAG
CTTGATCGTTTTGTAGTTCTGATTACAATTATTGCAATAGTACTTGGTGTAGCCTTTTTC
TTACTTGCTTTGCTATATATGAATTATAAAGTTACTGATTGCCTTGTCTTTGGTATTGGT
ATTCTAGTAGCTAATGTTCCTGAAGGTTTACTAGGTTGCATTACTATTTCGCTTGCCATT
ACTGCAAAGAATCTCTCAGCTAAAAATGTCCTTGTAAAAAACCTCGAAGCTGTAGAAACT
CTTGGTTCCACTTCTTGTATTTGCTCTGATAAAACTGGTACTTTAACTTAAAATGTTATG
TCGGTCAAAAATTTGTGGTATTCAGATTAGATTCACTTATCAAAGAACAAGACTCATCTT
AAGCAAGGAGAAATCCCTGAATATAATACTGAAGATCCTGACTTTAAAACTCTTTAGAAG
GCTGCCATGCTCAGTAGCGAAGCCCGCTTTGATACTTCTACTATTAAAGAAAGAGATAAT
ATCGACTACATGACCTGCCCAGTATTAGGAGATGCAACAGAAACTGGTATTATCAGATTC
TATCAATACATTGAAGATGTAAACTCCTTCCGTGAAAGATATAGAGTAGCTAAAAATCCT
GATGGTACTTAAGGTAAAATGCCTTTCAACTCATAGGTAAAGTTTGCTTTGACAATAATT
GAAGAGTAAACATAAGAAAGTTACTATACAGTTTACATCAAGGGAGCTCCAGAAAAGATT
TGGAGTTTCTGTTCATCGATTATTGTTAATGGTAAACCTTCCTAACTTAATGATAACTGG
TAAAAGAAATTCAAAGCTGTAAATCTCACTTTTGGTAAAGGTGGTGAAAGAGTACTTGGT
TTTGCTAAGTTGAGTTTACCTGCTGCTTAATTCCCTCAAGGATTTATTTTTAATGTGTCT
TCTATCTAAAAATTCCCCTTTAAACTTGCAAATTTCTAGTTTTGTGGTCTTATTTCTTTG
ATGGACCCCCCTAAATAGAGAGTCCCCTACGCTATTTTAGAATGTAGATCTGCAGGTGTT
AAGGTTATTATGGTAACTGGTGATTAACCTCCTACTGCTGCTGCTATTGCCAAAGAAGTC
AATATTATTCCCAAAGATATCCTAACCAATGAAGATCTTATGGAAAGAAATCCTAATCTC
AGCTGGTGGGAAGCAAGCGAATAATGCAGAGCTATTATTGTCCATGGAGATAGAATTACT
GAGTCTATCGACAAAGCTCTAAGTGAAAAAAAGGAAGATTGCTTTTATTTACGTTAATGG
GTAGTTAAACCTTATTGCGTTTTTGCTAGAACAACCCCAGCTCAAAAATTACAAATTGTT
GATGCATGCCAAAAGGAAGGATTCATCGTTGCTGCTACTGGTGATGGTGTAAATGACTCT
CCAGCCATCAAGAAAGCAGATATTGGTATTTCTATGAATATTTCTGGTTCCGATGTTACA
AAGGATGCTGCAGACATGGTCTTAGTTGATGATGATTTTGCATCAATAGTTTTGGGTGTA
GAAGAAGGTAGAAAAATTTTTGATAACTTAAAGAAGACAATTGTATATCTTCTAACTTCC
AACATGACTGAAATTGTTCCTTTCCTAGCCTTCATCATCCTCTAAATTCCCTTACCTCTT
TCCAGTATTTATATGCTTGTCATTTGTGTTGGTACTGATGTTTGGCCAGCTATTTCACTT
GCTTATGAAGAAGCAGAACTAGATGTAATGACGAGAAGACCTCGTAATAAATCTGAACAT
TTGGTTTCAAATAAGCTAATTACAATAGCTTATCTCTAAACAGGTTAGATTGCTAGTGGA
GCTGGCCATCTTGGTTATTATATTGCATTCAACTATTTTGGTTTCCCAGTACTTTCTTTA
TTCGGTCTTGCCTCTGCAACAGGATACAGACCTGTAAAAAATGACTTTGGAACTTATTAC
AATCCATTGCTATAAAGAGAAGATCCTTACTACAATGCAGCTATCTATAATATTACAAAA
TTCTAAGATTGCAACTAACTCTCAACCGACCAAAATAACGCTCTTTCAAATCTTTAATAT
TCTTTGGACTGGTTCACACTTTCTGAAGGTAATTATGATCTAAGAAAAGCTTTGGTTAAG
TGCGATCCTGTTACTGGTGCCTTTATACCTTGGATTAAATGGAGTGATTGTGATATTAAC
GAATCATAAAATTGGTCAGTTTTAACATCTTAAACTGCTTGCTATTCAGTAGAAGCTATC
AACTATGCCTAAAGTGTTTATTTCCTAACAGTTGTCTTACTTTAGTGGACAAATGTATTT
GCTTGCAAAAGTAGATCTATGAGTTTTACAACAACTGCTTTTAATTCAGTCATGATCTAA
GGTGTTATTTTCGAAACAATTTTAGTTATTTTCTTGCAATATGTACCTGGAGTCCAAACT
GTATTTGGCGGTAGACCTATGTTCTTCTGGTTATGGACAAGTTGTCTAGCCTATACAATG
TTACTACTTATATATGATGAACTAAGAAAATTCTTCTGTAGAAAAAACAGATGGTTTTAT
AAATATTGCTATTGGTGA


>g12922(gene)
ATGAATGTTGTTCGACAGTCCTCATCTGGCGTCGTAAGAAAATTTGAAGAAATGAGGTAG
TCCATCTAACTTAAAAATTCCATTCAAGAAATTAGATAAAGTTAGGAATTCTAAAAGCCA
AGAACTGAGTTGGAAGACGGAAACAAGCATTAGCACATTAACTGTGAAATTTAAGAAACA
ACAATTAAAACAGAAGGTTTTATGATTTCTAACACTCAAGCTGCTGATGTAGCTAAAAAT
ACTGTTAACAAAAAATTAAATAAGGATGAAAAATAAAAACAAGATATTGTTGAAAAAGTA
GACCACAAAATTTCTTTGGAGGAACTGAAATAAAAGTATCAAACTGATTTCCAGAATGGT
TTAACTGAACAAAAAGCTTAGGAATTACTAAAAAAGTATGGCGAGAATAAGCTTACTGTT
AAGTAAGGAACTCCATTATGGGTAAAACTCTTGAAAGAAATGACTAATGGCTTTTCACTC
ATGCTTTGGGTTAGTGCTATTCTATGTTTCATTGCTTAAGGATTGCAGCCAAATCCCTCT
AACATTTACCTTGCAGTAGTCCTCATTATTGTCATTTTAATTACCACTGCAATTACTTTC
TAATAAAATGCAAAGAGTGAAGCATTGATGAATTCTTTTAAAAATTTTATCCCTGCAAAG
ACAATAGTTATTAGAGGAGGTGAAATAAAGCAAATAGAAGCTGTACATCTTGTTGTCGGT
GACATAGTTATCATAAGAATAGGTGAAAAAATCCCCGCTGACATTCGTATTCTAGAATCA
AATGAAATGAAAGTAGATAATTCCCCTTTGACTGGTGAAAGTGAACCTCTATTGCGTACT
ACTGAATGCTCCCATCCTGAAAGCTATATTGAAACATCTAATATAGCCTTCTTCGGTACT
CTATGTAAAGAAGGTAACGGAAAGGGAATTGTTATCTGCACTGGTGATAATACTATGCTT
GGTTAGATTGCTGATTTGTCTTCTGGTGAAAAGAAAGTCAAAACTCCTCTCCGTGTTGAG
CTTGATCGTTTTGTAGTTCTGATTACAATTATTGCAATAGTACTTGGTGTAGCCTTTTTC
TTACTTGCTTTGCTATATATGAATTATAAAGTTACTGATTGCCTTGTCTTTGGTATTGGT
ATTCTAGTAGCTAATGTTCCTGAAGGTTTACTAGGTTGCATTACTATTTCGCTTGCCATT
ACTGCAAAGAATCTCTCAGCTAAAAATGTCCTTGTAAAAAACCTCGAAGCTGTAGAAACT
CTTGGTTCCACTTCTTGTATTTGCTCTGATAAAACTGGTACTTTAACTTAAAATGTTATG
TCGGTCAAAAATTTGTGGTATTCAGATTAGATTCACTTATCAAAGAACAAGACTCATCTT
AAGCAAGGAGAAATCCCTGAATATAATACTGAAGATCCTGACTTTAAAACTCTTTAGAAG
GCTGCCATGCTCAGTAGCGAAGCCCGCTTTGATACTTCTACTATTAAAGAAAGAGATAAT
ATCGACTACATGACCTGCCCAGTATTAGGAGATGCAACAGAAACTGGTATTATCAGATTC
TATCAATACATTGAAGATGTAAACTCCTTCCGTGAAAGATATAGAGTAGCTAAAAATCCT
GATGGTACTTAAGGTAAAATGCCTTTCAACTCATAGGTAAAGTTTGCTTTGACAATAATT
GAAGAGTAAACATAAGAAAGTTACTATACAGTTTACATCAAGGGAGCTCCAGAAAAGATT
TGGAGTTTCTGTTCATCGATTATTGTTAATGGTAAACCTTCCTAACTTAATGATAACTGG
TAAAAGAAATTCAAAGCTGTAAATCTCACTTTTGGTAAAGGTGGTGAAAGAGTACTTGGT
TTTGCTAAGTTGAGTTTACCTGCTGCTTAATTCCCTCAAGGATTTATTTTTAATGTGTCT
TCTATCTAAAAATTCCCCTTTAAACTTGCAAATTTCTAGTTTTGTGGTCTTATTTCTTTG
ATGGACCCCCCTAAATAGAGAGTCCCCTACGCTATTTTAGAATGTAGATCTGCAGGTGTT
AAGGTTATTATGGTAACTGGTGATTAACCTCCTACTGCTGCTGCTATTGCCAAAGAAGTC
AATATTATTCCCAAAGATATCCTAACCAATGAAGATCTTATGGAAAGAAATCCTAATCTC
AGCTGGTGGGAAGCAAGCGAATAATGCAGAGCTATTATTGTCCATGGAGATAGAATTACT
GAGTCTATCGACAAAGCTCTAAGTGAAAAAAAGGAAGATTGCTTTTATTTACGTTAATGG
GTAGTTAAACCTTATTGCGTTTTTGCTAGAACAACCCCAGCTCAAAAATTACAAATTGTT
GATGCATGCCAAAAGGAAGGATTCATCGTTGCTGCTACTGGTGATGGTGTAAATGACTCT
CCAGCCATCAAGAAAGCAGATATTGGTATTTCTATGAATATTTCTGGTTCCGATGTTACA
AAGGATGCTGCAGACATGGTCTTAGTTGATGATGATTTTGCATCAATAGTTTTGGGTGTA
GAAGAAGGTAGAAAAATTTTTGATAACTTAAAGAAGACAATTGTATATCTTCTAACTTCC
AACATGACTGAAATTGTTCCTTTCCTAGCCTTCATCATCCTCTAAATTCCCTTACCTCTT
TCCAGTATTTATATGCTTGTCATTTGTGTTGGTACTGATGTTTGGCCAGCTATTTCACTT
GCTTATGAAGAAGCAGAACTAGATGTAATGACGAGAAGACCTCGTAATAAATCTGAACAT
TTGGTTTCAAATAAGCTAATTACAATAGCTTATCTCTAAACAGGTTAGATTGCTAGTGGA
GCTGGCCATCTTGGTTATTATATTGCATTCAACTATTTTGGTTTCCCAGTACTTTCTTTA
TTCGGTCTTGCCTCTGCAACAGGATACAGACCTGTAAAAAATGACTTTGGAACTTATTAC
AATCCATTGCTATAAAGAGAAGATCCTTACTACAATGCAGCTATCTATAATATTACAAAA
TTCTAAGATTGCAACTAACTCTCAACCGACCAAAATAACGCTCTTTCAAATCTTTAATAT
TCTTTGGACTGGTTCACACTTTCTGAAGGTAATTATGATCTAAGAAAAGCTTTGGTTAAG
TGCGATCCTGTTACTGGTGCCTTTATACCTTGGATTAAATGGAGTGATTGTGATATTAAC
GAATCATAAAATTGGTCAGTTTTAACATCTTAAACTGCTTGCTATTCAGTAGAAGCTATC
AACTATGCCTAAAGTGTTTATTTCCTAACAGTTGTCTTACTTTAGTGGACAAATGTATTT
GCTTGCAAAAGTAGATCTATGAGTTTTACAACAACTGCTTTTAATTCAGTCATGATCTAA
GGTGTTATTTTCGAAACAATTTTAGTTATTTTCTTGCAATATGTACCTGGAGTCCAAACT
GTATTTGGCGGTAGACCTATGTTCTTCTGGTTATGGACAAGTTGTCTAGCCTATACAATG
TTACTACTTATATATGATGAACTAAGAAAATTCTTCTGTAGAAAAAACAGATGGTTTTAT
AAATATTGCTATTGGTGA