Identifiers and Description

Gene Model Identifier

TTHERM_00696910

Standard Name

TPA11 (Tetrahymena P-type ATPase )

Aliases

PreTt17488 | 108.m00140 | 3818.m00675

Description

Novel P-type ATPase with undefined ion specificity; shares certain homology to Plasmodium ATPase-1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00696910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000075149.997093137033517e-262locus:catp-8 Probable cation
-transporting ATPase C10C6.6
status:Confirmed UniProt:P9
0747 protein_id:CAB05683.2
Tetrahymena borealisEI9_18089.19.997093137033517e-262E1-E2 ATPase (1176 aa)
DictyBaseDDB_G02930049.997093137033517e-262ctaA on chromosome: 6 position
2385585 to 2389568
OxytrichaContig20606.0.g719.997093137033517e-262haloacid dehalogenase-like hyd
rolase
SGDYEL031W1.0004982362389172e-141SPF1 P-type ATPase, ion transp
orter of the ER membrane invol
ved in ER function and Ca2+ ho
meostasis; required for regula
ting Hmg2p degradation; confer
s sensitivity to a killer toxi
n (SMKT) produced by Pichia fa
rinosa KK1
Stentor CoeruleusSteCoe_309168.985825944049381e-37

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11952090: Linder JU, Schultz JE (2002) Guanylyl cyclases in unicellular organisms. Molecular and cellular biochemistry 230(1-2):149-58
  2. Ref:10428960: Linder JU, Engel P, Reimer A, Krüger T, Plattner H, Schultz A, Schultz JE (1999) Guanylyl cyclases with the topology of mammalian adenylyl cyclases and an N-terminal P-type ATPase-like domain in Paramecium, Tetrahymena and Plasmodium. The EMBO journal 18(15):4222-32
  3. Ref:9124316: Wang S, Takeyasu K (1997) Primary structure and evolution of the ATP-binding domains of the P-type ATPases in Tetrahymena thermophila. The American journal of physiology 272(2 Pt 1):C715-28
  4. Ref:9405804: Wang S, Gao D, Penny J, Krishna S, Takeyasu K (1997) P-type ATPases in Tetrahymena. Annals of the New York Academy of Sciences 834( ):158-60

Sequences

>TTHERM_00696910(coding)
ATGGTAAAATCAACTTCAATAGATTTTACTCTTTTAAAAGAAAAGAAAAAGCTTTTTAGG
TATGATGTGTTTCCATTCATATTCATACACTCAGCAGTTTTGTATTGGTGGTACGAGTCT
TCTGAAGAGGATGATGTTTACCCTAGATTAGCGGTTATAGTATCAGCATTTTTAAATTGT
ATAGCTTACTTATTAGGACATTGGTCTTAGAGAATGAAGGCTAAAATATGTTTTTCATCT
TTTGGTAAAGACAAATCTGATGATGCCTTAAATAACGCAACTTTTGTTTTTGTCCATTTT
GAAAAGAAATCTGTTCGTACTGTCTATGAGATAGTTCCTTTGAAATATGATACTGATAAT
GACATCTTTTTCATTCATTTTACTGAAAAAAAATACATATTTAATAATGAAAAAAGAGAA
TTTTATCGCCTAAAACCTTGCCTCAAAGATCTTAAAATCAAGGATTTCTAAAGCCTTGAA
GTCAAGCAAGATACAACTAATTTTGATTTAAATTCTCTTGAAATTCCTATCAGAAAATTT
GCAGATGTTTTCAAGGATTAAATTATGGAACCTTTCTCATTCTTTTAGATTTTCAGTGTT
TCCTTATGGCTTATGGATGAAAACAGATTTTACTCATTATTAACATTATTTATGCTATTT
ATGAGTGCCTTTACTGTTGTTATTCAACGTATGAGAACTATGATGATGCTTCGTTAAATG
AAGTTATAACCTCAATACATTAATGTATTAAGAGATAAAAAGTGGGTTAAAATAAGCTCT
GAAGAACTTATGCCTGGAGATATTGTTCAAATTCAAACTGCAGAAAGCATAAAAGCAGCT
GAAACTACAAACTAAATTTCAGATGAAGAATACTTAAAGTAGCAAATTCCATATGCTCAT
TTATTCCCTTAAAAGTTATTCGTAACTGAAAGCTCGAATGCAAATACTTTTAAATATCTT
CCATGTGATATGCTTATTCTCTCTGGTACATGTGTTGTTAACGAGTCAGTACTTACTGGT
GAGTCTGTACCTTAAATCAAGGACTCCATAGAAAAGGTACATGGTGATGAAATCCTAGAT
TTAAAGAATAAACACAAAAACTCAGTTCTATTTTGTGGTACAGAAGTTATTTAAACTTTC
CCAAGTGATAGATATCCTGAAAGTATTAGAAATAGACCAGATAAATAATCTTGTTTAGCT
TACGTTCTTAGAACAGGTTTTGATACATCAAAAGGCAAACTCATTCGTACTGTCATTTTC
AATAATGAAAATGTTTAAATTAAGTAGAAAGACGCTTTTGCTTTAATCTTTGTACTCTTG
ATCTTCTCTATTATTTCTTCAGCTTACGTTTTAATTCATGGATTGGAAGATTAAGAAAGA
AGCAAAAATAAGCTTTTCATTCGTTGTATACTTATTATTACCACTGTAGTTCCTCCTGAA
CTTCCTATGATTCTAACTATCGCAGTTAACAGCTCACTTTTATATCTTCAAAGAAAGAAA
ATTTTCTGTACTGAACCATATAGAATTCCATTTGGAGGTAAAATTACCATGTGCGCTTTT
GACAAGACTGGTACTCTTACAAGTGATACATTGAAGTTTAAAGGTATTGTTGATAACACT
CAAGATTTTAAGACTCTCAAAGGTAAATCTGATGTAAACATTCAAGCTTAATGTGTTCTT
GCTGGTTGTCACTCCCTTTTACAAACTGATAAAAAACTTTAAGGTGACCCTATTGAAACA
TTATTCTTTGAAGAAAGCGAATGGACCTATAATTCTGGAACAAAAATAGCAAAAAAGAAA
GGAGCTGAATGCAGAATTATTAACATGTTCCCTTTCAAGAGTGATTTAAAAAGAATGTCT
ACTGTTGTCCACTGGGAAGGTGAAGGTGCAAGCAAAGAATATAGAGTTTTATGTAAAGGT
GCTCCAGAAACTATTGAATAGCTTTTAACAGAAGTTCCACCAAACTATGTTAAGGCATAC
AAGTACTATTCCAAGCTTGGCTACAGAGTACTTAGTTTAGCATATGGAAAGTTAAATCCT
GATATGAACTTAAACGATGTTGAAAGATAAGATATTGAAAAAAATCTTACATTTGCTGGT
CTTTTTATTTGTGACTCACCTCTAAAATTTGATACCAAACAGTACATTACTATCTTGTAA
CAAGCTAAATACTAGCTTTTAATGATTACAGGTGATAATATTTTGACAGCTGTTGCAGTT
AGCAATAAGCTTGATTTTGGTCCTCATGATTATCTCGTTTTAGAAACCAAAGATGGTTAA
AATTTTGTTTGGATTGATTCTGAAGAAAAAGAAAAAAAAGCTAATATTACTCTTTAAGAA
CTTAAAGACATATGCCAGAAGTATACTCTTTGCTTAATAGGACCTACTATTGATGTGATG
ATAAGAAAAACTCCTCTAGACCTTCAAAAAATTATTTACAAGCATGTTTAAATTTATGCT
CGTACTTCTCCAGCTCAGAAAGAACATATCATATTCACATTGAGATAAGCAGGTGAGCAT
TGCTTAATGTGTGGTGATGGTACAAATGATGTAGGAGCTCTTAAAAAGGCTGATTTAGGT
ATTGCTCTTGTTGGTATCAAAGAAGATAACCCTTAAGAACGTAGATAAGAAAAAGAAAGA
AAGAAAAAGATCCAAGAAGAAATTAAAAGAGATTACAAAAAAATGATGTAATATATGAAA
GAAGAGTAAGAGAAAAAGAAAAACTAAAGCATGTTTGGAGATTCGATAGAGTACAAAGTT
GGCGATGCTTGTATTGCTGCTCCTTTTACTAACAAGCATTCAAATTCTATCAGATGTGTT
ATTATTTTACTTCGTTAAGGTATTTGCACTCTTGTAACAACAATTTAAACTTATAAGATT
TTAGCCCTTAATTCACTCCTTTCTGCTTACAATCTCTCTGTTCTTAACTTAGAAGCTCTT
AAATTCTCAGAAACTTAATAAACTATTCTTGGTATAACCTCAGCTATAGCCTTTTATTAA
TTTTCAAATTCTAAGCCTTTAAAACAAATATCTCCCGTTAAACCTGTTAGCACAATTTTC
GAGCCTTACTTCTTCCTTTCTGTAATTGGATAGGTAGCCTTGCACTTATATGGAAATTCT
AAGTGTGTTGATATTGGTTTGAAATACTCAACAAAGGAAGATCTTGCAATTACTCACGAT
TAAGAGTTTAAGCCAACATTCCTAAACACTACAATTTTCTTATTCAGCTTGTTATCTTAA
ACTTGCATTTTCCTTTTCAACAATGGAGGTGAACCTCATATGGAAGGATTTTCTAAACAC
ACAAAGTTCTTTAAAATATTAATTGCATGTTTAGCTGGTTCCTTCATTTTTTCAATGAAT
CTTTTCCCAGAATTATCAGAATACTTTGAATTAAAGTTCGAAGGAGTTCCTGAAGAAGCT
AACAATGAGTTGGTAACTGTTTTCTCAATCATAGCTGTCACAAACTATGTCATGGAAATT
AGTTTAAGATATCTTAAGTTCGGAAAGCTATTTAACTGGATTTGA


>TTHERM_00696910(protein)
MVKSTSIDFTLLKEKKKLFRYDVFPFIFIHSAVLYWWYESSEEDDVYPRLAVIVSAFLNC
IAYLLGHWSQRMKAKICFSSFGKDKSDDALNNATFVFVHFEKKSVRTVYEIVPLKYDTDN
DIFFIHFTEKKYIFNNEKREFYRLKPCLKDLKIKDFQSLEVKQDTTNFDLNSLEIPIRKF
ADVFKDQIMEPFSFFQIFSVSLWLMDENRFYSLLTLFMLFMSAFTVVIQRMRTMMMLRQM
KLQPQYINVLRDKKWVKISSEELMPGDIVQIQTAESIKAAETTNQISDEEYLKQQIPYAH
LFPQKLFVTESSNANTFKYLPCDMLILSGTCVVNESVLTGESVPQIKDSIEKVHGDEILD
LKNKHKNSVLFCGTEVIQTFPSDRYPESIRNRPDKQSCLAYVLRTGFDTSKGKLIRTVIF
NNENVQIKQKDAFALIFVLLIFSIISSAYVLIHGLEDQERSKNKLFIRCILIITTVVPPE
LPMILTIAVNSSLLYLQRKKIFCTEPYRIPFGGKITMCAFDKTGTLTSDTLKFKGIVDNT
QDFKTLKGKSDVNIQAQCVLAGCHSLLQTDKKLQGDPIETLFFEESEWTYNSGTKIAKKK
GAECRIINMFPFKSDLKRMSTVVHWEGEGASKEYRVLCKGAPETIEQLLTEVPPNYVKAY
KYYSKLGYRVLSLAYGKLNPDMNLNDVERQDIEKNLTFAGLFICDSPLKFDTKQYITILQ
QAKYQLLMITGDNILTAVAVSNKLDFGPHDYLVLETKDGQNFVWIDSEEKEKKANITLQE
LKDICQKYTLCLIGPTIDVMIRKTPLDLQKIIYKHVQIYARTSPAQKEHIIFTLRQAGEH
CLMCGDGTNDVGALKKADLGIALVGIKEDNPQERRQEKERKKKIQEEIKRDYKKMMQYMK
EEQEKKKNQSMFGDSIEYKVGDACIAAPFTNKHSNSIRCVIILLRQGICTLVTTIQTYKI
LALNSLLSAYNLSVLNLEALKFSETQQTILGITSAIAFYQFSNSKPLKQISPVKPVSTIF
EPYFFLSVIGQVALHLYGNSKCVDIGLKYSTKEDLAITHDQEFKPTFLNTTIFLFSLLSQ
TCIFLFNNGGEPHMEGFSKHTKFFKILIACLAGSFIFSMNLFPELSEYFELKFEGVPEEA
NNELVTVFSIIAVTNYVMEISLRYLKFGKLFNWI


>TTHERM_00696910(gene)
ATGGTAAAATCAACTTCAATAGATTTTACTCTTTTAAAAGAAAAGAAAAAGCTTTTTAGG
TATGATGTGTTTCCATTCATATTCATACACTCAGCAGTTTTGTATTGGTGGTACGAGTCT
TCTGAAGAGGATGATGTTTACCCTAGATTAGCGGTTATAGTATCAGCATTTTTAAATTGT
ATAGCTTACTTATTAGGACATTGGTCTTAGAGAATGAAGGCTAAAATATGTTTTTCATCT
TTTGGTAAAGACAAATCTGATGATGCCTTAAATAACGCAACTTTTGTTTTTGTCCATTTT
GAAAAGAAATCTGTTCGTACTGTCTATGAGATAGTTCCTTTGAAATATGATACTGATAAT
GACATCTTTTTCATTCATTTTACTGAAAAAAAATACATATTTAATAATGAAAAAAGAGAA
TTTTATCGCCTAAAACCTTGCCTCAAAGATCTTAAAATCAAGGATTTCTAAAGCCTTGAA
GTCAAGCAAGATACAACTAATTTTGATTTAAATTCTCTTGAAATTCCTATCAGAAAATTT
GCAGATGTTTTCAAGGATTAAATTATGGAGTAATTTGAATTAATTCAATAAAATGATTTA
ATAAAAACTTAAAAGCTTAACAAAAATATTGTGTCTTAAACAATAATACTTACTTTATCG
TTTGAGGGCAACATTTAATATTTATTTAATCAACTAAATTTTAGTTATAAAAATATAAAG
CGCTTAAGTTTGAAGCTAATAAAAGACTCATAAAAATATTAACTTACTTTTTATTTTTAA
TTTACAAAAGACCTTTCTCATTCTTTTAGATTTTCAGTGTTTCCTTATGGCTTATGGATG
AAAACAGATTTTACTCATTATTAACATTATTTATGCTATTTATGAGTGCCTTTACTGTTG
TTATTCAACGTATGAGAACTATGATGATGCTTCGTTAAATGAAGTTATAACCTCAATACA
TTAATGTATTAAGAGATAAAAAGTGGGTTAAAATAAGCTCTGAAGAACTTATGCCTGGAG
ATATTGTTCAAATTCAAACTGCAGAAAGCATAAAAGCAGCTGAAACTACAAACTAAATTT
CAGATGAAGAATACTTAAAGTAGCAAATTCCATATGCTCATTTATTCCCTTAAAAGTTAT
TCGTAACTGAAAGCTCGAATGCAAATACTTTTAAATATCTTCCATGTGATATGCTTATTC
TCTCTGGTACATGTGTTGTTAACGAGTCAGTACTTACTGGTGAGTCTGTACCTTAAATCA
AGGACTCCATAGAAAAGGTAAATAGCAAACAGCATGTTTAATATTTTGAAATTCAGGAGA
AATTAAATTTTAAATAATTTAAAATAAAAAATTGAATGAATTTATTTTTATATTTTTGAT
TTAAAATTTAATTTTTTTATTTTTGTTAAATTTAAATACTAAGGTACATGGTGATGAAAT
CCTAGATTTAAAGAATAAACACAAAAACTCAGTTCTATTTTGTGGTACAGAAGTTATTTA
AACTTTCCCAAGTGATAGATATCCTGAAAGTATTAGAAATAGACCAGATAAATAATCTTG
TTTAGCTTACGTTCTTAGAACAGGTTTTGATACATCAAAAGGCAAACTCATTCGTACTGT
CATTTTCAATAATGAAAATGTTTAAATTAAGTAGAAAGACGCTTTTGCTTTAATCTTTGT
ACTCTTGATCTTCTCTATTATTTCTTCAGCTTACGTTTTAATTCATGGATTGGAAGATTA
AGAAAGAAGCAAAAATAAGCTTTTCATTCGTTGTATACTTATTATTACCACTGTAGTTCC
TCCTGAACTTCCTATGATTCTAACTATCGCAGTTAACAGCTCACTTTTATATCTTCAAAG
AAAGAAAATTTTCTGTACTGAACCATATAGAATTCCATTTGGAGGTAAAATTACCATGTG
CGCTTTTGACAAGACTGGTACTCTTACAAGTGATACATTGAAGTTTAAAGGTATTGTTGA
TAACACTCAAGATTTTAAGACTCTCAAAGGTAAATCTGATGTAAACATTCAAGCTTAATG
TGTTCTTGCTGGTTGTCACTCCCTTTTACAAACTGATAAAAAACTTTAAGGTATAAATCC
ATCTTACAAAACTTATAATAAAAACAAACAATATTAAATATAAATTTAACTTTTGCAAAA
TCTTTATTTTGATAAAAAGAAAATTTTAGATTATATTCAACTTTTGAAATTGAAATAATT
ACTTTAATTTTAATTAATAATTAGGTGACCCTATTGAAACATTATTCTTTGAAGAAAGCG
AATGGACCTATAATTCTGGAACAAAAATAGCAAAAAAGAAAGGAGCTGAATGCAGAATTA
TTAACATGTTCCCTTTCAAGAGTGATTTAAAAAGAATGTCTACTGTTGTCCACTGGGAAG
GTGAAGGTGCAAGCAAAGAATATAGAGTTTTATGTAAAGGTGCTCCAGAAACTATTGAAT
AGCTTTTAACAGAAGTTCCACCAAACTATGTTAAGGCATACAAGTACTATTCCAAGCTTG
GCTACAGAGTACTTAGTTTAGCATATGGAAAGTTAAATCCTGATATGAACTTAAACGATG
TTGAAAGATAAGATATTGAAAAAAATCTTACATTTGCTGGTCTTTTTATTTGTGACTCAC
CTCTAAAATTTGATACCAAACAGTACATTACTATCTTGTAACAAGCTAAATACTAGCTTT
TAATGATTACAGGTGATAATATTTTGACAGCTGTTGCAGTTAGCAATAAGCTTGATTTTG
GTCCTCATGATTATCTCGTTTTAGAAACCAAAGATGGTTAAAATTTTGTTTGGATTGATT
CTGAAGAAAAAGAAAAAAAAGCTAATATTACTCTTTAAGAACTTAAAGACATATGCCAGA
AGTATACTCTTTGCTTAATAGGACCTACTATTGATGTGATGATAAGAAAAACTCCTCTAG
ACCTTCAAAAAATTATTTACAAGCATGTTTAAATTTATGCTCGTACTTCTCCAGCTCAGA
AAGAACATATCATATTCACATTGAGATAAGCAGGTGAGCATTGCTTAATGTGTGGTGATG
GTACAAATGATGTAGGAGCTCTTAAAAAGGCTGATTTAGGTATTGCTCTTGTTGGTATCA
AAGAAGATAACCCTTAAGAACGTAGATAAGAAAAAGAAAGAAAGAAAAAGATCCAAGAAG
AAATTAAAAGAGGTAATTTTAAATAAAATATTTTTTTTTTCTTCAAAAATTATTAAAATT
TATTTAATAACTTTCTATGACAGACTAAAAAAATGAAATATATCCTCGATTTATTTTAAT
AAAATTTTACCTATCCTTAGCATTAATTTTATTTACTTACTTTGAAGACTATTTAAAAGT
TTTTTAAATTCAATTTATCGAATATTTACTTTCAAGACTATTCAAAAGTTTCTGAAATTA
AATTTATCGAATGAATATTTATTTATTTTTCTAAAATTAAAATTATTTTAATTTATTTAT
TTTTAGATAAGGAAATATTTTTTGATAATTTGAAAATTTTCATTTTTGATTTAATATAAA
AATAGATAAATAAATTAATAATATTATGAATATTTCCAATTTTCCTTCAATTATTTATTA
TAATTTAACTAAATTTTAATAAAACAGATTACAAAAAAATGATGTAATATATGAAAGAAG
AGTAAGAGAAAAAGAAAAACTAAAGCATGTTTGGAGATTCGATAGAGTACAAAGTTGGCG
ATGCTTGTATTGCTGCTCCTTTTACTAACAAGCATTCAAATTCTATCAGATGTGTTATTA
TTTTACTTCGTTAAGGTATTTGCACTCTTGTAACAACAATTTAAACTTATAAGATTTTAG
CCCTTAATTCACTCCTTTCTGCTTACAATCTCTCTGTTCTTAACTTAGAAGCTCTTAAAT
TCTCAGAAACTTAATAAACTATTCTTGGTATAACCTCAGCTATAGCCTTTTATTAATTTT
CAAATTCTAAGCCTTTAAAACAAATATCTCCCGTTAAACCTGTTAGCACAATTTTCGAGC
CTTACTTCTTCCTTTCTGTAATTGGATAGGTAGCCTTGCACTTATATGGAAATTCTAAGT
GTGTTGATATTGGTTTGAAATACTCAACAAAGGAAGATCTTGCAATTACTCACGATTAAG
AGTTTAAGCCAACATTCCTAAACACTACAATTTTCTTATTCAGCTTGTTATCTTAAACTT
GCATTTTCCTTTTCAACAATGGAGGTGAACCTCATATGGAAGGATTTTCTAAACACACAA
AGTTCTTTAAAATATTAATTGCATGTTTAGCTGGTTCCTTCATTTTTTCAATGAATCTTT
TCCCAGAATTATCAGAATACTTTGAATTAAAGTTCGAAGGAGTTCCTGAAGAAGCTAACA
ATGAGTTGGTAACTGTTTTCTCAATCATAGCTGTCACAAACTATGTCATGGAAATTAGTT
TAAGATATCTTAAGTTCGGAAAGCTATTTAACTGGATTTGA