Identifiers and Description

Gene Model Identifier

TTHERM_00499470

Standard Name

TPA10 (Tetrahymena P-type ATPase )

Aliases

PreTt07990 | 63.m00168 | 3716.m00022

Description

Novel P-type ATPase with undefined ion specificity; shares certain homology to Plasmodium ATPase-1; constitutively expressed; expression upregulated at 37C and downregulated by starvation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00122 ) E1-E2 ATPase
  • ( TIGR00099 ) Cof-like hydrolase
  • ( TIGR01497 ) K+-transporting ATPase, B subunit
  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( PF08282 ) haloacid dehalogenase-like hydrolase
  • ( PF00690 ) Cation transporter/ATPase, N-terminus
  • ( PF07112 ) Protein of unknown function (DUF1368)
  • ( TIGR01512 ) cadmium-translocating P-type ATPase
  • ( TIGR01524 ) magnesium-translocating P-type ATPase
  • ( TIGR01525 ) heavy metal translocating P-type ATPase
  • ( TIGR01647 ) plasma-membrane proton-efflux P-type ATPase
  • ( TIGR01522 ) calcium-transporting P-type ATPase, PMR1-type
  • ( TIGR01517 ) calcium-translocating P-type ATPase, PMCA-type
  • ( TIGR01116 ) calcium-translocating P-type ATPase, SERCA-type
  • ( TIGR01523 ) potassium/sodium efflux P-type ATPase, fungal-type
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01657 ) P-type ATPase of unknown pump
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00499470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09686.19.997093137033517e-262E1-E2 ATPase (1193 aa)
OxytrichaContig21988.0.g644.000089512234839e-180E1-E2 ATPase
DictyBaseDDB_G02848491.999126889527329e-167DDB_G0284849 on chromosome: 4
position 2557758 to 2561551
WormBaseWBGene000220106.997264088033092e-153locus:catp-7 status:Partiall
y_confirmed UniProt:Q86FP2
protein_id:CCD71143.1
SGDYOR291W1.99972299831384e-147YPK9 Vacuolar protein with a p
ossible role in sequestering h
eavy metals; has similarity to
the type V P-type ATPase Spf1
p; homolog of human ATP13A2 (P
ARK9), mutations in which are
associated with Parkinson dise
ase and Kufor-Rakeb syndrome
Stentor CoeruleusSteCoe_350577.362997122252211e-76

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11952090: Linder JU, Schultz JE (2002) Guanylyl cyclases in unicellular organisms. Molecular and cellular biochemistry 230(1-2):149-58
  2. Ref:10428960: Linder JU, Engel P, Reimer A, Krüger T, Plattner H, Schultz A, Schultz JE (1999) Guanylyl cyclases with the topology of mammalian adenylyl cyclases and an N-terminal P-type ATPase-like domain in Paramecium, Tetrahymena and Plasmodium. The EMBO journal 18(15):4222-32
  3. Ref:9405804: Wang S, Gao D, Penny J, Krishna S, Takeyasu K (1997) P-type ATPases in Tetrahymena. Annals of the New York Academy of Sciences 834( ):158-60
  4. Ref:9124316: Wang S, Takeyasu K (1997) Primary structure and evolution of the ATP-binding domains of the P-type ATPases in Tetrahymena thermophila. The American journal of physiology 272(2 Pt 1):C715-28

Sequences

>TTHERM_00499470(coding)
ATGAATACAGAAAATCAACAATAGATATAGATTGAAGAAAAAAAGTATAATTCTTTAAAA
ACTATTCCTCAGTAGGGTCTATAATGTAAATAGTATTACAAAGCTTAAGAAGAGTGCTTG
ATTGAAAAGGTCTATCCTGTATAAAAACCTTTAAGCTTACTTATACTAGAAATAACTCTT
TACATATTATCTGGAGGTTTACTTTTTATATTATTTTCTTGGAATAATGAATGGAAATTT
AAAATATTCTTTAAACTTGTTAATATTAATTAAGCTACTTAAATTGTAGTTTATGGACCA
GATAAGGATGTCTAGATAGAAAAAATTGTGAATTTAGAAAACAAATGTATTTTTCAATAT
AGATTTTAAAAATTTGTTTATGATGAATAGTCCTTAATTTTCGTGCCATTTGGCGATAGT
ATAATCGAAAGAAACCATAAAGAAATTATTGAGTCAGCTAAAACGGGTTTAAATGACTCT
TAGATTAATTCCTCTATTACTAAAAACGGAGTTAATTCTACTGATATACCAGATTAAGGC
GTTTTGGTTCTAGCATTTCATGAATTCTTTTCTCCTTTCTTCTTGTTTCAAGTTGCAAGT
TGTCTTTTATGGTATTTTGATACTTATGAAATCTATGCTACAGTTATTATTACCACATCA
ACTTTTAGTTTGCTTTTTAAGTTATACGAAGAAAGAACAAATATAAATCGTATAAAAAAA
TTAAGCTATTTTAGGGGTTAAACAACAGTAGTTAGAAATGGACAAACCAAAGTTATCTCT
TCAAACGAGTTAGCATATGGCGATGTTGTTATTTTAAAAGAGGGTGAGACAGCTCCATGT
GATATGGTGATAGTAGAAGGTAGTGTCATAGTAAACGAATCTATGCTTACTGGAGAATCC
GTTCCTATTATCAAATCTGCTCTAGCAGATTTAGACTGCTAATTTAGCGAAAATCGTTAA
AATATTATTTATGGTGGAAGTTAGGTTATGATGGTTTCAAATTCCAAGTTAGTAGTTATT
AGAATAGGTTTTGAAACTCTTAAAGGGAACTTGATCCGTTCCATCCTTTATCCAAAGCAA
CATAATCAAATTTCATTTTAGAATGATTCTGTTAAATTCTTATCTATCCTTCTATTTGTT
ACATTGATATAATTCTTTATTGCATTACCAACTTTCATTGATAACTTAGATCGAGGTACT
ATGGATTCATCAGATTTAATTAAAAAATTTTTTGATTTAATCACCATCAGTGTTCCTCCT
GCTTTGCCAACATGCCTTTCCTTTGGTGTCTCCTTCTCGTTAAATAGAATGCGTAGAAAA
CAAATTTTTTGTATCAATAATGAAAAAATTAATATTTGCGGTATTGTAAAAAGTGTGTGT
TTTGATAAGACTGGTACTTTGACTGAAGAGCTCCTATCCTTTAAACTTATTTCTTCATTT
TTAAGTAGCTCAAACAAATTTGAAGATTAGTTTTCTGAAGAAGCTGCTAAAAAAAACAAA
CACATATTTCCTACCTTCTCCAAAATTTAAAGATAAATTATAGCATCGTGCCACAGTATC
ATGGTTTATAATAACGAATTTATTGGAGATCCTTTGGACATTGAAATGTTTAAAAATTCA
TCATATTGCTTAGTTGAAAATGAAAATTCAAAAAGCGATAACTAGGCAGATTAAAATGAT
AAATTATTTTATTAAGGTTATGAAGTTTTGCAAGAACTTACTTGCAACAAAAGTTTAGGA
TCACCAATTTTTATTCTGAAAAGATTTTAATTTGATGCTGATGTTTAAAGAATGTCGGTT
ATAGTAGCTATTACAAAAGAAAATCAAAATTATATCTATACAAAAGGCTCACCTGAAAGC
ATTCAGAAAATTTGTAAATAATAAACTATTCCCAATGACTTTTCAAATAAATTATAAGAA
TTTACAAATGAAGGATATCGTGTTCTTGCATTAGCTTATAGTTAGATTAATGAAGTTGAT
TTTGAAAAAGACAGAAACCAATACGAAGCAAACCTAACTTTTGCAGGTTTTTTGGTATTT
GAAAACAAATTAAAACCAGAAACAACAGAACATATCAAACTACTTAAAAATAATGACGTT
TAAGTCCGTATGGTAACTGGTGACAATCCTGAAACTTCCTTGAATATTGCTAAACAATGT
GGAATTTTAAGTTTAAATTAGTAAATTAATCTCCTTGATTATAGTAATAATTAATTTACA
ATGAATGGAAAAAAATCTGATTTAGATTAATTTATAAATTCAGCTTCATTTGTTTAAGGA
TAGGAATAGTTAGTTATTACTGGTAATTTTTTTGAAGAATTCCTCCAAAACAAAACAAAT
CAGAATTCATAATAAAACCAATGCGACATTGAAAGCAATACTTGCTCAAAGAGAACTAGC
TTATTCTTTACTCTTATTTTATAGTACGGAAAAGTTTTTGCGAGAATGAAGCCAGATTAG
AAGTAAAGCTTAATACATCTATTGCAAAAGTATTAAAATCCAGAGTAAGGATACTCATTT
GTTGGAATGTGTGGTGATGGTGCAAATGACTGCTAAGCTCTGAAAGATGCTGATATGGGT
ATTTCATTAGGTGAAGCAGAGGCTTCCGTTGCAGCTGCTTTCACAAGCAAGGTTATTAAT
ATAAGTGTTATTGAATACATTTTACGTGAAGGTAGATGCTGCTTAACAACTTCATTTTAA
TGCTTTAAGTACATGGCCCTTTACTCTCTTATATAAGGTTTCACTTAAACTTTGACTTAT
TTTCGTGGTACACAACCAGCTGATATGTAGATTCTGTATTGGGATCTTTTTATTATCATT
CCTCTAACATTTTTCTTAGGCTTAACTGAAGCTAGTGATAAACTTACACCTGATATTCCA
GCACATCGGCTTTTCTCATACAAAAATATACTCTCTGTTGCTGGCTAAGGTGTTATTTAA
CTCTTGTTTTTAATCATAACAGTAGCTACTACATGTAATCAAAGCTGGTATCTTAACCCA
TAATAATTATCTAAAGCTTAAGAATTTGAAGACGAAGAATTAGCACCAACTACATATGAC
ACAACTGTTCTATTCTGGGTTTCTAACTTCTAATACATTTTCACTGTAATAGCTTTTTCT
ATTGGTTCTGTTCATAAAAAACCATTCTATACAAACATTCTATTCACTTTCTTCCTTGTT
TCAATCACAGGCTTGAGTTTACTAATTATTTTCTCAGAACAATAACCCATACTTGATTTC
TTTACTCTTTTTATCAAAGCTACTAATTAAAATGATGAAATCGTTTCATAAATGGATTAT
AGCTGGAAATTCGTAATTTTAGCTATTATTTTAGCAAATGCTATAGTAACAATATTGTAC
GAAAAGTATTTCTTAGCATTTTTAAATAATTTACTTGATAAAAAATATAGAAAGGCTTAT
TAAAATGTTGAAAGTACAACTGTAACTTAAGAAATCTAAAAAGTATGCACTTCAACTTCT
CCGAAGTGA


>TTHERM_00499470(protein)
MNTENQQQIQIEEKKYNSLKTIPQQGLQCKQYYKAQEECLIEKVYPVQKPLSLLILEITL
YILSGGLLFILFSWNNEWKFKIFFKLVNINQATQIVVYGPDKDVQIEKIVNLENKCIFQY
RFQKFVYDEQSLIFVPFGDSIIERNHKEIIESAKTGLNDSQINSSITKNGVNSTDIPDQG
VLVLAFHEFFSPFFLFQVASCLLWYFDTYEIYATVIITTSTFSLLFKLYEERTNINRIKK
LSYFRGQTTVVRNGQTKVISSNELAYGDVVILKEGETAPCDMVIVEGSVIVNESMLTGES
VPIIKSALADLDCQFSENRQNIIYGGSQVMMVSNSKLVVIRIGFETLKGNLIRSILYPKQ
HNQISFQNDSVKFLSILLFVTLIQFFIALPTFIDNLDRGTMDSSDLIKKFFDLITISVPP
ALPTCLSFGVSFSLNRMRRKQIFCINNEKINICGIVKSVCFDKTGTLTEELLSFKLISSF
LSSSNKFEDQFSEEAAKKNKHIFPTFSKIQRQIIASCHSIMVYNNEFIGDPLDIEMFKNS
SYCLVENENSKSDNQADQNDKLFYQGYEVLQELTCNKSLGSPIFILKRFQFDADVQRMSV
IVAITKENQNYIYTKGSPESIQKICKQQTIPNDFSNKLQEFTNEGYRVLALAYSQINEVD
FEKDRNQYEANLTFAGFLVFENKLKPETTEHIKLLKNNDVQVRMVTGDNPETSLNIAKQC
GILSLNQQINLLDYSNNQFTMNGKKSDLDQFINSASFVQGQEQLVITGNFFEEFLQNKTN
QNSQQNQCDIESNTCSKRTSLFFTLILQYGKVFARMKPDQKQSLIHLLQKYQNPEQGYSF
VGMCGDGANDCQALKDADMGISLGEAEASVAAAFTSKVINISVIEYILREGRCCLTTSFQ
CFKYMALYSLIQGFTQTLTYFRGTQPADMQILYWDLFIIIPLTFFLGLTEASDKLTPDIP
AHRLFSYKNILSVAGQGVIQLLFLIITVATTCNQSWYLNPQQLSKAQEFEDEELAPTTYD
TTVLFWVSNFQYIFTVIAFSIGSVHKKPFYTNILFTFFLVSITGLSLLIIFSEQQPILDF
FTLFIKATNQNDEIVSQMDYSWKFVILAIILANAIVTILYEKYFLAFLNNLLDKKYRKAY
QNVESTTVTQEIQKVCTSTSPK


>TTHERM_00499470(gene)
ATGAATACAGAAAATCAACAATAGATATAGATTGAAGAAAAAAAGTATAATTCTTTAAAA
ACTATTCCTCAGTAGGGTCTATAATGTAAATAGTATTACAAAGCTTAAGAAGAGTGCTTG
ATTGAAAAGGTCTATCCTGTATAAAAACCTTTAAGCTTACTTATACTAGAAATAACTCTT
TACATATTATCTGGAGGTTTACTTTTTATATTATTTTCTTGGAATAATGAATGGAAATTT
AAAATATTCTTTAAACTTGTTAATATTAATTAAGCTACTTAAATTGTAGTTTATGGACCA
GATAAGGATGTCTAGATAGAAAAAATTGTGAATTTAGAAAACAAATGTATTTTTCAATAT
AGATTTTAAAAATTTGTTTATGATGAATAGTCCTTAATTTTCGTGCCATTTGGCGATAGT
ATAATCGAAAGAAACCATAAAGAAATTATTGAGTCAGCTAAAACGGGTTTAAATGACTCT
TAGATTAATTCCTCTATTACTAAAAACGGAGTTAATTCTACTGATATACCAGATTAAGGC
GTTTTGGTTCTAGCATTTCATGAATTCTTTTCTCCTTTCTTCTTGTTTCAAGTTGCAAGT
TGTCTTTTATGGTATTTTGATACTTATGAAATCTATGCTACAGTTATTATTACCACATCA
ACTTTTAGTTTGCTTTTTAAGTTATACGAAGAAAGAACAAATATAAATCGTATAAAAAAA
TTAAGCTATTTTAGGGGTTAAACAACAGTAGTTAGAAATGGACAAACCAAAGTTATCTCT
TCAAACGAGTTAGCATATGGCGATGTTGTTATTTTAAAAGAGGGTGAGACAGCTCCATGT
GATATGGTGATAGTAGAAGGTAGTGTCATAGTAAACGAATCTATGCTTACTGGAGAATCC
GTTCCTATTATCAAATCTGCTCTAGCAGATTTAGACTGCTAATTTAGCGAAAATCGTTAA
AATATTATTTATGGTGGAAGTTAGGTTATGATGGTTTCAAATTCCAAGTTAGTAGTTATT
AGAATAGGTTTTGAAACTCTTAAAGGGAACTTGATCCGTTCCATCCTTTATCCAAAGCAA
CATAATCAAATTTCATTTTAGAATGATTCTGTTAAATTCTTATCTATCCTTCTATTTGTT
ACATTGATATAATTCTTTATTGCATTACCAACTTTCATTGATAACTTAGATCGAGGTACT
ATGGATTCATCAGATTTAATTAAAAAATTTTTTGATTTAATCACCATCAGTGTTCCTCCT
GCTTTGCCAACATGCCTTTCCTTTGGTGTCTCCTTCTCGTTAAATAGAATGCGTAGAAAA
CAAATTTTTTGTATCAATAATGAAAAAATTAATATTTGCGGTATTGTAAAAAGTGTGTGT
TTTGATAAGACTGGTACTTTGACTGAAGAGCTCCTATCCTTTAAACTTATTTCTTCATTT
TTAAGTAGCTCAAACAAATTTGAAGATTAGTTTTCTGAAGAAGCTGCTAAAAAAAACAAA
CACATATTTCCTACCTTCTCCAAAATTTAAAGATAAATTATAGCATCGTGCCACAGTATC
ATGGTTTATAATAACGAATTTATTGGAGATCCTTTGGACATTGAAATGTTTAAAAATTCA
TCATATTGCTTAGTTGAAAATGAAAATTCAAAAAGCGATAACTAGGCAGATTAAAATGAT
AAATTATTTTATTAAGGTTATGAAGTTTTGCAAGAACTTACTTGCAACAAAAGTTTAGGA
TCACCAATTTTTATTCTGAAAAGATTTTAATTTGATGCTGATGTTTAAAGAATGTCGGTT
ATAGTAGCTATTACAAAAGAAAATCAAAATTATATCTATACAAAAGGCTCACCTGAAAGC
ATTCAGAAAATTTGTAAATAATAAACTATTCCCAATGACTTTTCAAATAAATTATAAGAA
TTTACAAATGAAGGATATCGTGTTCTTGCATTAGCTTATAGTTAGATTAATGAAGTTGAT
TTTGAAAAAGACAGAAACCAATACGAAGCAAACCTAACTTTTGCAGGTTTTTTGGTATTT
GAAAACAAATTAAAACCAGAAACAACAGAACATATCAAACTACTTAAAAATAATGACGTT
TAAGTCCGTATGGTAACTGGTGACAATCCTGAAACTTCCTTGAATATTGCTAAACAATGT
GGAATTTTAAGTTTAAATTAGTAAATTAATCTCCTTGATTATAGTAATAATTAATTTACA
ATGAATGGAAAAAAATCTGATTTAGATTAATTTATAAATTCAGCTTCATTTGTTTAAGGA
TAGGAATAGTTAGTTATTACTGGTAATTTTTTTGAAGAATTCCTCCAAAACAAAACAAAT
CAGAATTCATAATAAAACCAATGCGACATTGAAAGCAATACTTGCTCAAAGAGAACTAGC
TTATTCTTTACTCTTATTTTATAGTACGGAAAAGTTTTTGCGAGAATGAAGCCAGATTAG
AAGTAAAGCTTAATACATCTATTGCAAAAGTATTAAAATCCAGAGTAAGGATACTCATTT
GTTGGAATGTGTGGTGATGGTGCAAATGACTGCTAAGCTCTGAAAGATGCTGATATGGGT
ATTTCATTAGGTGAAGCAGAGGCTTCCGTTGCAGCTGCTTTCACAAGCAAGGTTATTAAT
ATAAGTGTTATTGAATACATTTTACGTGAAGGTAGATGCTGCTTAACAACTTCATTTTAA
TGCTTTAAGTACATGGCCCTTTACTCTCTTATATAAGGTTTCACTTAAACTTTGACTTAT
TTTCGTGGTACACAACCAGCTGATATGTAGATTCTGTATTGGGATCTTTTTATTATCATT
CCTCTAACATTTTTCTTAGGCTTAACTGAAGCTAGTGATAAACTTACACCTGATATTCCA
GCACATCGGCTTTTCTCATACAAAAATATACTCTCTGTTGCTGGCTAAGGTGTTATTTAA
CTCTTGTTTTTAATCATAACAGTAGCTACTACATGTAATCAAAGCTGGTATCTTAACCCA
TAATAATTATCTAAAGCTTAAGAATTTGAAGACGAAGAATTAGCACCAACTACATATGAC
ACAACTGTTCTATTCTGGGTTTCTAACTTCTAATACATTTTCACTGTAATAGCTTTTTCT
ATTGGTTCTGTTCATAAAAAACCATTCTATACAAACATTCTATTCACTTTCTTCCTTGTT
TCAATCACAGGCTTGAGTTTACTAATTATTTTCTCAGAACAATAACCCATACTTGATTTC
TTTACTCTTTTTATCAAAGCTACTAATTAAAATGATGAAATCGTTTCATAAATGGATTAT
AGCTGGAAATTCGTAATTTTAGCTATTATTTTAGCAAATGCTATAGTAACAATATTGTAC
GAAAAGTATTTCTTAGCATTTTTAAATAATTTACTTGATAAAAAATATAGAAAGGCTTAT
TAAAATGTTGAAAGTACAACTGTAACTTAAGAAATCTAAAAAGTATGCACTTCAACTTCT
CCGAAGTGA