Identifiers and Description

Gene Model Identifier

TTHERM_00497920

Standard Name

TOP3 (TOPoisomerase III)

Aliases

PreTt06957 | 62.m00241 | 3715.m00102

Description

DNA topoisomerase I

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00497920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08991.19.997093137033517e-262DNA topoisomerase (1308 aa)
WormBaseWBGene000129951.9999565133760522e-166DNA topoisomerase status:Par
tially_confirmed UniProt:H1U
BJ9 protein_id:CCF23416.1
OxytrichaContig18848.0.g1061.999382702437002e-145DNA topoisomerase
DictyBaseDDB_G02752574.0008598455422075e-100top3 on chromosome: 2 position
5038466 to 5041076
Stentor CoeruleusSteCoe_69312.970445045520691e-73
SGDYLR234W2.9997879492220375e-71TOP3 DNA Topoisomerase III, co
nserved protein that functions
in a complex with Sgs1p and R
mi1p to relax single-stranded
negatively-supercoiled DNA pre
ferentially, involved in telom
ere stability and regulation o
f mitotic recombination

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497920(coding)
ATGAGCACAGATAAGGAAAATCTCTCTAACAATAATCCATATTCATCATGGCACAGTTCT
AAGAAGTAAAAATAATTAGAAGACAAAAGTAACACATACATGTCACAATAAAATTCCTCT
AAAAATCTAAACAAAAATGTAAGTTAATCAAGCTAGAAGACTAACAATAATAATCGCAAT
AATAATAGAAAAAAAAGGGGTTATCAGTAAAATGTAGAGCATGTGTATGTTCGAAAAGAT
CTTGTTTAAACAATATCTTAGAGTTGTAATATTTAAAAAAATTCAAATAATGATAATCCT
AATCAGTATAAATAATAAGATTCAAGATAAGTTGAGAACAGAAGCCTAAATAAAACAAAT
CTAAGATAATATTAAAATTAATAAAATAATTTTAAAAATGAAGAACTCATAAATATGAAA
GCAAACATTGGATAGGAATAAATAAAAGAACAAAATATTTAAGCTAGAACAAACTAAAAA
TAATAAGTGTAAGATTTTAAGAATGAATGGAGTTCTGATCCAAAAAAATACTTAACTTAA
AAATTCTACAAAAATGAAGATAAATGTTATAATGAAACATATAATATTTATAGTGGGAAA
AAAGGATAGATTTAAGAAGTACTATTGGTAGCTGAAAAACCTTCTGTAGCTAGAAAAATT
GCATCCGCTTTATCAAATAAAACATCCAAAAAAAGATAAGGGAAAGTTAGATATCTACCT
GTCTATGTATATGAAGGTAGATTCAAAGGATAGAAAACCATTTTTAAGGTAACTAGTGTA
ACTGGTCATGTTTATGATTTAGATTTTCCTTAAAAGCTTAAAGAAAATTGGAATGAAATT
AATCCTGTGTAATTATTTTCATCAGATACATTAAAGATTCCAAGCAAGCATAATATTGTG
AGGCATTTAGAATCAGAAGCAAGAAATTGTTCTTACCTACTTCTTTGGCTTGATAATGAT
AAAGAAGGAGAAAACATATGCTTTGAAGTAAAATAAATTTGTGAAAAAGTTATGTGTTTC
AAAGGAGATAATGTATAGTAAGTATTGAGAACAAGATTTTCTTCTCTGACAAAGTAAGAT
ATAATAAAAGCATTTAATGGAACTACTGATCCTCCTAACGTTAACGAATCGAAAGCTGTA
GATGCTCGTAGAATTATTGATCTAAAAATAGGTGCTTCTTTCACTAGATATTAAACTCTT
TTCTTTAGAAATAAATATCCTGATTTAAACAAAAGGACTATTTCTTTTGGTCCATGCTAG
ACACCAACGCTTGGGTTTTGTGTGGAAAGAGAGGATTAAATCAAAAAATTCATCCCAAGT
TTACTCTATAAAGTAAAGTTAACACTTTAGGGAAGTGATAATAAAACTTAAATGTTAGCT
TATAGTGAACAAAAAGAAACACTTTCTAAAGAAAAAGCTTAATACATATTCTAAAGTATT
AAACTTGAAAAACACATTTAAATAGTATCTGTTTCATCTGAGACTTTAGTAGAAGAATGC
CCAGTTGGTCTAAATACAGTTGAAATGCTGAAAGCTGCATCAAGTAGCTTGAATATGAGT
CCACAACAAACTATGGATGCTGCTGAAAATCTATATTTAAAAGGATTTATCACATATCCT
AGAACAGAGTCAACGGCTTATTCAAGCTCATTTAATTTCAAAAAAGTTTTGTCAAGTCTA
TAGCAAGATATAGAATATGGGAAATTCGCATAAAATCTACTTAATGATGGTTATATAATA
CCACAAAAAGGAAATGATACGGAAGATCATCCACCTATTACTCCAACTTCAAACTATCCA
AGACCAGAAAATGAGGGTTTAATAAGCCCATAAGAAAAATAATTATATGATTACATTTCA
AAACATTTCATAGCAAGCTTGTACGATGATTATGAGTATAAGAAATTAAACATAACATGT
CAAGTGAAAAATTACTAATTTATCTCTGAAGCTATTAGAGTAGAAAAATAAGGATATACA
AAAGTTATTAAGTCAACTTAACTCGATTAAAACATCATCTAAATTGATGTAAAGTAAAGT
AGTAAATTCTAAATAAAAAACATAAGTATTGAAGAAGAATATTCATCTCCTCCTCGTTAT
TTATCAGAATCTGAGCTTATTGATTTAATGTCAAAAAATTCTATTGGTACTGATGCCTCA
ATACCTACTCATATACAAAATATTGTTGATAGAAAATATGTTGAAATTGATCAAAAAAAT
AGAACCTTAATACCAACATAATTAGGAAGATCTATTATAGATGGTTATAGAAAAATAGAC
GAAGAACTTGTTTCACCATAAATTAGAGCTTAAATTGAAAATTCAGTTAATTAGATTGCT
AAAGGTGATAAGGAATTTTCTTAGGTATTAAATGAATCATTAGGTTTATTTTAAAATAAA
TACATCAATTTTGTTTATAATATTAAAAATATGGATAATTTAGTCGGATTATTCTGCAAA
ACTTATAAAGAAGTACTTTAGACAGCAAAACCTCTAAGTAAATGCGGTTTTTGTTAAAGC
ATCATGAAATTTATAGAATAATCTGAATAAGTGGTTTGTCAAAAATGTGATATTAAATTT
TATTTGCCTAAGAGTGGAGATTTAAAAATAAGCGAAGATAAGATTTGCCTTAAAGATAAT
TTTTAAATCATCTAATTCACATCTTAAAACTCAAATGAAGGTGTAATTGATATCTGTCCA
AATTGTTACTCAGATTAATTTTACAGAAAGCAAAAAAAATACTAATTATGA


>TTHERM_00497920(protein)
MSTDKENLSNNNPYSSWHSSKKQKQLEDKSNTYMSQQNSSKNLNKNVSQSSQKTNNNNRN
NNRKKRGYQQNVEHVYVRKDLVQTISQSCNIQKNSNNDNPNQYKQQDSRQVENRSLNKTN
LRQYQNQQNNFKNEELINMKANIGQEQIKEQNIQARTNQKQQVQDFKNEWSSDPKKYLTQ
KFYKNEDKCYNETYNIYSGKKGQIQEVLLVAEKPSVARKIASALSNKTSKKRQGKVRYLP
VYVYEGRFKGQKTIFKVTSVTGHVYDLDFPQKLKENWNEINPVQLFSSDTLKIPSKHNIV
RHLESEARNCSYLLLWLDNDKEGENICFEVKQICEKVMCFKGDNVQQVLRTRFSSLTKQD
IIKAFNGTTDPPNVNESKAVDARRIIDLKIGASFTRYQTLFFRNKYPDLNKRTISFGPCQ
TPTLGFCVEREDQIKKFIPSLLYKVKLTLQGSDNKTQMLAYSEQKETLSKEKAQYIFQSI
KLEKHIQIVSVSSETLVEECPVGLNTVEMLKAASSSLNMSPQQTMDAAENLYLKGFITYP
RTESTAYSSSFNFKKVLSSLQQDIEYGKFAQNLLNDGYIIPQKGNDTEDHPPITPTSNYP
RPENEGLISPQEKQLYDYISKHFIASLYDDYEYKKLNITCQVKNYQFISEAIRVEKQGYT
KVIKSTQLDQNIIQIDVKQSSKFQIKNISIEEEYSSPPRYLSESELIDLMSKNSIGTDAS
IPTHIQNIVDRKYVEIDQKNRTLIPTQLGRSIIDGYRKIDEELVSPQIRAQIENSVNQIA
KGDKEFSQVLNESLGLFQNKYINFVYNIKNMDNLVGLFCKTYKEVLQTAKPLSKCGFCQS
IMKFIEQSEQVVCQKCDIKFYLPKSGDLKISEDKICLKDNFQIIQFTSQNSNEGVIDICP
NCYSDQFYRKQKKYQL


>TTHERM_00497920(gene)
ATGAGCACAGATAAGGAAAATCTCTCTAACAATAATCCATATTCATCATGGCACAGTTCT
AAGAAGTAAAAATAATTAGAAGACAAAAGTAACACATACATGTCACAATAAAATTCCTCT
AAAAATCTAAACAAAAATGTAAGTTAATCAAGCTAGAAGACTAACAATAATAATCGCAAT
AATAATAGAAAAAAAAGGGGTTATCAGTAAAATGTAGAGCATGTGTATGTTCGAAAAGAT
CTTGTTTAAACAATATCTTAGAGTTGTAATATTTAAAAAAATTCAAATAATGATAATCCT
AATCAGTATAAATAATAAGATTCAAGATAAGTTGAGAACAGAAGCCTAAATAAAACAAAT
CTAAGATAATATTAAAATTAATAAAATAATTTTAAAAATGAAGAACTCATAAATATGAAA
GCAAACATTGGATAGGAATAAATAAAAGAACAAAATATTTAAGCTAGAACAAACTAAAAA
TAATAAGTGTAAGATTTTAAGAATGAATGGAGTTCTGATCCAAAAAAATACTTAACTTAA
AAATTCTACAAAAATGAAGATAAATGTTATAATGAAACATATAATATTTATAGTGGGAAA
AAAGGATAGATTTAAGAAGTACTATTGGTAGCTGAAAAACCTTCTGTAGCTAGAAAAATT
GCATCCGCTTTATCAAATAAAACATCCAAAAAAAGATAAGGGAAAGTTAGATATCTACCT
GTCTATGTATATGAAGGTAGATTCAAAGGATAGAAAACCATTTTTAAGGTAACTAGTGTA
ACTGGTCATGTTTATGATTTAGATTTTCCTTAAAAGCTTAAAGAAAATTGGAATGAAATT
AATCCTGTGTAATTATTTTCATCAGATACATTAAAGATTCCAAGCAAGCATAATATTGTG
AGGCATTTAGAATCAGAAGCAAGAAATTGTTCTTACCTACTTCTTTGGCTTGATAATGAT
AAAGAAGGAGAAAACATATGCTTTGAAGTAAAATAAATTTGTGAAAAAGTTATGTGTTTC
AAAGGAGATAATGTATAGTAAGTATTGAGAACAAGATTTTCTTCTCTGACAAAGTAAGAT
ATAATAAAAGCATTTAATGGAACTACTGATCCTCCTAACGTTAACGAATCGAAAGCTGTA
GATGCTCGTAGAATTATTGATCTAAAAATAGGTGCTTCTTTCACTAGATATTAAACTCTT
TTCTTTAGAAATAAATATCCTGATTTAAACAAAAGGACTATTTCTTTTGGTCCATGCTAG
ACACCAACGCTTGGGTTTTGTGTGGAAAGAGAGGATTAAATCAAAAAATTCATCCCAAGT
TTACTCTATAAAGTAAAGTTAACACTTTAGGGAAGTGATAATAAAACTTAAATGTTAGCT
TATAGTGAACAAAAAGAAACACTTTCTAAAGAAAAAGCTTAATACATATTCTAAAGTATT
AAACTTGAAAAACACATTTAAATAGTATCTGTTTCATCTGAGACTTTAGTAGAAGAATGC
CCAGTTGGTCTAAATACAGTTGAAATGCTGAAAGCTGCATCAAGTAGCTTGAATATGAGT
CCACAACAAACTATGGATGCTGCTGAAAATCTATATTTAAAAGGATTTATCACATATCCT
AGAACAGAGTCAACGGCTTATTCAAGCTCATTTAATTTCAAAAAAGTTTTGTCAAGTCTA
TAGCAAGATATAGAATATGGGAAATTCGCATAAAATCTACTTAATGATGGTTATATAATA
CCACAAAAAGGAAATGATACGGAAGATCATCCACCTATTACTCCAACTTCAAACTATCCA
AGACCAGAAAATGAGGGTTTAATAAGCCCATAAGAAAAATAATTATATGATTACATTTCA
AAACATTTCATAGCAAGCTTGTACGATGATTATGAGTATAAGAAATTAAACATAACATGT
CAAGTGAAAAATTACTAATTTATCTCTGAAGCTATTAGAGTAGAAAAATAAGGATATACA
AAAGTTATTAAGTCAACTTAACTCGATTAAAACATCATCTAAATTGATGTAAAGTAAAGT
AGTAAATTCTAAATAAAAAACATAAGTATTGAAGAAGAATATTCATCTCCTCCTCGTTAT
TTATCAGAATCTGAGCTTATTGATTTAATGTCAAAAAATTCTATTGGTACTGATGCCTCA
ATACCTACTCATATACAAAATATTGTTGATAGAAAATATGTTGAAATTGATCAAAAAAAT
AGAACCTTAATACCAACATAATTAGGAAGATCTATTATAGATGGTTATAGAAAAATAGAC
GAAGAACTTGTTTCACCATAAATTAGAGCTTAAATTGAAAATTCAGTTAATTAGATTGCT
AAAGGTGATAAGGAATTTTCTTAGGTATTAAATGAATCATTAGGTTTATTTTAAAATAAA
TACATCAATTTTGTTTATAATATTAAAAATATGGATAATTTAGTCGGATTATTCTGCAAA
ACTTATAAAGAAGTACTTTAGACAGCAAAACCTCTAAGTAAATGCGGTTTTTGTTAAAGC
ATCATGAAATTTATAGAATAATCTGAATAAGTGGTTTGTCAAAAATGTGATATTAAATTT
TATTTGCCTAAGAGTGGAGATTTAAAAATAAGCGAAGATAAGATTTGCCTTAAAGATAAT
TTTTAAATCATCTAATTCACATCTTAAAACTCAAATGAAGGTGTAATTGATATCTGTCCA
AATTGTTACTCAGATTAATTTTACAGAAAGCAAAAAAAATACTAATTATGA