Identifiers and Description

Gene Model Identifier

TTHERM_00825440

Standard Name

TOP2 (TOPoisomerase II)

Aliases

PreTt04008 | 142.m00105 | 3683.m00038

Description

DNA gyrase/topoisomerase IV, A subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01059 ) DNA gyrase, B subunit
  • ( TIGR01063 ) DNA gyrase, A subunit
  • ( TIGR01055 ) DNA topoisomerase IV, B subunit
  • ( TIGR01058 ) DNA topoisomerase IV, B subunit
  • ( TIGR01062 ) DNA topoisomerase IV, A subunit
  • ( PF00521 ) DNA gyrase/topoisomerase IV, A subunit
  • ( PF00204 ) DNA topoisomerase II (N-terminal region)
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00825440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_197540
WormBaseWBGene000107859.997093137033517e-262locus:top-2 Probable DNA top
oisomerase 2 status:Partiall
y_confirmed UniProt:Q23670
protein_id:CAA88867.1
Tetrahymena borealisEI9_18275.19.997093137033517e-262DNA gyrase/topoisomerase IV, A
subunit protein (1796 aa)
DictyBaseDDB_G02704189.997093137033517e-262top2 on chromosome: 1 position
4831688 to 4836353
OxytrichaContig14442.0.g1089.997093137033517e-262DNA gyrase/topoisomerase IV, s
ubunit A
SGDYNL088W9.997093137033517e-262TOP2 Topoisomerase II, relieve
s torsional strain in DNA by c
leaving and re-sealing the pho
sphodiester backbone of both p
ositively and negatively super
coiled DNA; cleaves complement
ary strands; localizes to axia
l cores in meiosis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825440(coding)
ATGAGCAAGCAGGAAAAATCAGTAGAAGAAAGATATTAAAAAAAATCCCAAATTGAGCAT
ATTCTTCTTCGTCCTGACTCTTATGTTGGGTCTATAGAAAATGAATAAAAGTCATTATGG
ATTCTAAACAAGGAGGGAACAGCATTAGAAGAAAAAGAAATAGATTTCGTTCCAGCATTT
TATAAAATATTTGATGAAATTATAGTCAATGCTGCAGATAACTTTTAAAGAAATTAAGAT
GGAGCTCCTATGGATACAATAAAAGTTATGATTGATCAATAAAATCAAATGATCTCAGTT
TGGAATAATGGACAAGGAATCCCTATATAAATTCATAAAGAGCATAATATTTATATTCCA
GAAATGATTTTTGGTCATCTATTAACAAGCTCTAATTACGATGATAAAGAAGAGAAAGTA
GTAGGCGGTCGTAATGGATTTGGTGCTAAATTAACAAATATTTTTTCTAAAAAATTCATT
GTTGAATGCAATGATGACAAGCGTAAAAAATATTACAAGTAAGAATGGCGTAAAAATATG
TCTGAAAGAACAGAGCCTTTGATTACAGAAAATAAAAAAGGTGGTAATTTCACATGTGTA
ACATTCTATCCTGACCTTTCTAAATTCAAGATGCAAAATATTTCTGATGATATGGCAAAT
TTACTAAGAAAAAGAGTTTATGATATGGCTGGTATTTTTAACAATAAGGTCAAAGTTTAT
TTGAATAATGAACAAATAAAAATAAAATCCTTTAGTTAATATGTTAACTTGTTTATACCT
GACATTGAAGAACAATACAAATGCTATGATCCAACTATGACTTCTGACAGATGGGAGATT
TTAGTTACTTTTTCAGATGGTTAATTTAAGTAAGTATCGTTTGTAAATGGTATTTGCACA
TCTAGAGGTGGTAAGCATGTAGATTTTGTCATTGATAAAATTGTTGAGAGAATGCAAGAA
TAAATCTTGAAAAAGAATAAAGATCTTGATATCAAGCCTCATTAAATCAAACAAAATTTA
TTCATATTTATGAATTGCCTTATTGTTAACCCTTCGTTTGATTCTCAAACCAAAGACACT
CTTACAACAAAAGCCTCAGCTTTTGGATCAAAACCTGAATTATCAGAAAAATTTATCAAA
AAAATATTGGGTACTGGTATCATTGAGTAAATTGTTTCCTAAGCTAAAGCTCGTCAGAAT
GCTAAATTAGCAAAAACTTTAAAGGGTGGGAAAAAAGGAAGAATTACAGGTATCCCAAAA
CTTGATGATGCTAATGATGCAGGAACAGCAAGAAGTGAAAACTGTACATTAATCTTAACC
GAAGGAGATTCAGCTAAAGCATTAGCAATGGCTGGTATAGAAGTTGTAGGTAGGGATAAT
TATGGTGTATTCCCATTAAAGGGTAAGCTACTTAATGTTAGAGAAGCAAATAAGAAATAG
ATCATCGAAAACCAAGAAATATAAAATATATGCAAAATCATAGGGCTAGATCCTGCTGTT
TAAAACTATGAAAATACAAAGCAATTAAGGTACGGATCTTTAATGATCATGGCTGATTAG
GATAGTGATGGTTCCCATATTAAAGGTTTGGTCATAAACTTTATTCATCACTTCTGGCCT
TCTCTGTTTAAAATGAAAGGGTTTTTAAAAGAATTTATTACTCCCATCCTTAAAGTTACA
AAAGGAGATGAAGTTCATTCATTCTTTACAATATAAGATTTCAAAAATTTTGCTGCTTAA
AAAGGAGACCGCCTTAAGTAATACAAAGTTAAGTACTACAAAGGTCTTGGTACTTCGACT
GACAAAGAAGCTAAAGAATATTTCTCCAATTTCTATAAGCATCAAATTAATTTTTAATAT
TTAGATGAAAACGATATGGAAGCTATTGAATTAGGTTTTTCAGGTAAAAAAATAAAAGAA
CGTAAGGACTGGCTAGCTAATTATGATCCTAATTCATTTGTTGATTATAATATAAAATAA
TTAAGATACAAGGATTTTATTGATAGAGAGCTTATTCACTTCTCAAATGCTGATAATTTA
AGATCTATCCCATCGTTATGTGATGGCCTAAAGCCTGGTCAAAGAAAAATTCTATTTTCT
TGTTTTAAAAGAAATTTAAAATCAGAAATCAAAGTAGCTTAATTAATTGGTTATGTTGCT
GAGCACTCTGCATATCACCACGGTGAATAATCACTCGCTTCAACTATCATCGGAATGGCA
TAAAATTTTGTAGGTTCTAATAATATAAATCTTATGATGCCTATTGGTTAGTTTGGTACA
CGTAATCAAGGTGGAAAAGAGCATGCCTCTGCAAGATACATTTTTACAAGTCTGAGCAAA
ATTACTAGAATACTTTTTCCAGAGCATGATGATCATGTACTGAAGTATTTAGAAGACGAT
AATCAAGTAGTAGAACCAGAATGGTACATGCCAATTATTCCTATGTGTTTAGTAAATGGT
AGTAGTGGTATTGGTACTGGTTGGTCAACTGATATTCCTAACTATAATCACAAGGAAATT
GTTGAATAAATTAGAGGGAAGCTGGAAGGAAAGCCATTTACTGAATTACATCCTTGGTAC
AAAGGATTTTAAGGTTAAATAGAAATTAATCCTAAAGGTGGGTATATAGTCAAAGGGTAA
TACGAAATCGATGAAGTTGAAGAAACAATAAAAATTACTGAATTACCTGTTGGTAAATGG
ACAAGAGACTATAAGAATTATTTAGAAGAGCTACTATCACCACCAAAAGGAGAACCTGAA
ATTGAAGACATTCGTGAATATCATACAAATAATAGAGTTCATTTTGAAGTACAAGCAATA
CCAGGGAGAATATAATAATGGGGTGACATTGAGAAAAAGCTTAAATTAAGCACAACAATG
CAAACAACTAATATAGTTATGTTTAATGATAAATATAAATTAAAAAGATATCAAAGTACT
GTAGAAATAATGGAAGAATTTTATGCTTTACGTCTCAAATGCTACTAAAAAAGAAAAGAT
TATTTAGTCAGCAAAATTCAAAGAGATGTTGATATTTTATAAAATAAGATGAAATTTATT
ACATTAGTTGTCAATGGTACTTTGGAAATTAGAAATGCCAGAAAGAAAGGAGTTCTGAAT
AAACTTAAGGAGTTAGGTCTGACTCCAATGTCAAAAATAACCAGAATCAATTCGACAAAA
ATCTAGGCATTTGAAGAAAAAAAGAAAGAAAGTTAAGCTGAAAAAAATGAAGATAATGAA
GATGAAGAAGTTTAATAAGACGAAGAGGAAGAAGAAGAATAAGTTTAAGAAGGAGAAATT
CCTTTATCTGAATACAACTACCTTCTCTCTATGCCTATCTTTTCTTTGACAGAAGAAAAG
GTATTATAACTCAAAAAATAAGTAGAAGAAAAGGAAAGTGAACTTTTGATCTTATAAAAG
AAAGAAATAAAAGATATGTGGACAGAAGATTTAGATAAATTCATAGAAGTTATTGAATAA
GTAGAAGAAAAAGAAGAAAAAGAGAGACTTACAGGTAAAGGGTTTACATAGAATGGCAAA
GCCCGTGCTAAAAAGAAAAATAACAATAAAGAAAAAGAATAAAAAAAATAATAAAATAAC
TCTTCAGATGACGAAAGCGAAAAGAAAACTGTTGTAAAAAATAAAAATCCATAAAAATCT
GATAATGAAAAATAAAAGCCAAAAGAAAATAATGATAAATAAAAGAAAATAGATGAAAGT
TTTCTTGTGAAGAAAAAAATGGATGCAGAACAATAAAAAACAGAAGAAAAGGTATAAAAG
AAAGAATAGAAGAAAGAGCCAATGAAGTAGCTCTCACTGATTGAAAGAATATCTTAAAAA
TATAGTAATCAGGCGGAATAATAAGTAACGGCAGATATACTTGACACAAATAAACGTAAA
AAAGATCCATCTTCAACTTCTACCTCTGTTTATTCAATGGATATGCCATAATAAAACCTA
AAGCGAAAGAAAAATAATAAATTGAAAGAAGATGATGATGATTTTGACCTTGATTTAGAT
TTCTTAGAACCTAGTTAGATAATTATGAATCCTAGCTAAGATCCTAATAAAAGAACCTTA
AGGTCAAATGGGAAGAAGCCAAGAACGATTTATAAACTAGATTCGGATTCTGATAATGAT
GAATTCAATCAGTAAAATGATGAATCTGATGAAGAAGAGGAAGAGGAATTTGTTATGATG
CCTTCTAAGAGCAATAAGAAAAAATTATTTGATGAGGATGAGGATGATTGA


>TTHERM_00825440(protein)
MSKQEKSVEERYQKKSQIEHILLRPDSYVGSIENEQKSLWILNKEGTALEEKEIDFVPAF
YKIFDEIIVNAADNFQRNQDGAPMDTIKVMIDQQNQMISVWNNGQGIPIQIHKEHNIYIP
EMIFGHLLTSSNYDDKEEKVVGGRNGFGAKLTNIFSKKFIVECNDDKRKKYYKQEWRKNM
SERTEPLITENKKGGNFTCVTFYPDLSKFKMQNISDDMANLLRKRVYDMAGIFNNKVKVY
LNNEQIKIKSFSQYVNLFIPDIEEQYKCYDPTMTSDRWEILVTFSDGQFKQVSFVNGICT
SRGGKHVDFVIDKIVERMQEQILKKNKDLDIKPHQIKQNLFIFMNCLIVNPSFDSQTKDT
LTTKASAFGSKPELSEKFIKKILGTGIIEQIVSQAKARQNAKLAKTLKGGKKGRITGIPK
LDDANDAGTARSENCTLILTEGDSAKALAMAGIEVVGRDNYGVFPLKGKLLNVREANKKQ
IIENQEIQNICKIIGLDPAVQNYENTKQLRYGSLMIMADQDSDGSHIKGLVINFIHHFWP
SLFKMKGFLKEFITPILKVTKGDEVHSFFTIQDFKNFAAQKGDRLKQYKVKYYKGLGTST
DKEAKEYFSNFYKHQINFQYLDENDMEAIELGFSGKKIKERKDWLANYDPNSFVDYNIKQ
LRYKDFIDRELIHFSNADNLRSIPSLCDGLKPGQRKILFSCFKRNLKSEIKVAQLIGYVA
EHSAYHHGEQSLASTIIGMAQNFVGSNNINLMMPIGQFGTRNQGGKEHASARYIFTSLSK
ITRILFPEHDDHVLKYLEDDNQVVEPEWYMPIIPMCLVNGSSGIGTGWSTDIPNYNHKEI
VEQIRGKLEGKPFTELHPWYKGFQGQIEINPKGGYIVKGQYEIDEVEETIKITELPVGKW
TRDYKNYLEELLSPPKGEPEIEDIREYHTNNRVHFEVQAIPGRIQQWGDIEKKLKLSTTM
QTTNIVMFNDKYKLKRYQSTVEIMEEFYALRLKCYQKRKDYLVSKIQRDVDILQNKMKFI
TLVVNGTLEIRNARKKGVLNKLKELGLTPMSKITRINSTKIQAFEEKKKESQAEKNEDNE
DEEVQQDEEEEEEQVQEGEIPLSEYNYLLSMPIFSLTEEKVLQLKKQVEEKESELLILQK
KEIKDMWTEDLDKFIEVIEQVEEKEEKERLTGKGFTQNGKARAKKKNNNKEKEQKKQQNN
SSDDESEKKTVVKNKNPQKSDNEKQKPKENNDKQKKIDESFLVKKKMDAEQQKTEEKVQK
KEQKKEPMKQLSLIERISQKYSNQAEQQVTADILDTNKRKKDPSSTSTSVYSMDMPQQNL
KRKKNNKLKEDDDDFDLDLDFLEPSQIIMNPSQDPNKRTLRSNGKKPRTIYKLDSDSDND
EFNQQNDESDEEEEEEFVMMPSKSNKKKLFDEDEDD


>TTHERM_00825440(gene)
ATGAGCAAGCAGGAAAAATCAGTAGAAGAAAGATATTAAAAAAAATCCCAAATTGAGCAT
ATTCTTCTTCGTCCTGACTCTTATGTTGGGTCTATAGAAAATGAATAAAAGGTAAACTAT
AATTTGTTTATTTATTGAATACAACTTAGATAGCTTATATTAAATTTAATATAAAATAGT
CATTATGGATTCTAAACAAGGAGGGAACAGCATTAGAAGAAAAAGAAATAGATTTCGTTC
CAGCATTTTATAAAATATTTGATGAAATTATAGTCAATGCTGCAGATAACTTTTAAAGAA
ATTAAGATGGAGCTCCTATGGATACAATAAAAGTTATGATTGATCAATAAAATCAAATGA
TCTCAGTTTGGAATAATGGACAAGGAATCCCTATATAAATTCATAAAGAGCATAATATTT
ATATTCCAGAAATGATTTTTGGTCATCTATTAACAAGCTCTAATTACGATGATAAAGAAG
AGAAAGTAGTAGGCGGTCGTAATGGATTTGGTGCTAAATTAACAAATATTTTTTCTAAAA
AATTCATTGTTGAATGCAATGATGACAAGCGTAAAAAGTAAAATTTAACTAAAATCTATA
ATTTCTTATCCATTTAAATTTAACTTTAGATATTACAAGTAAGAATGGCGTAAAAATATG
TCTGAAAGAACAGAGCCTTTGATTACAGAAAATAAAAAAGGTGGTAATTTCACATGTGTA
ACATTCTATCCTGACCTTTCTAAATTCAAGATGCAAAATATTTCTGATGATATGGCAAAT
TTACTAAGAAAAAGAGTTTATGATATGGCTGGTATTTTTAACAATAAGGTCAAAGTTTAT
TTGAATAATGAACAAATAAAAATAAAATCCTTTAGTTAATATGTTAACTTGTTTATACCT
GACATTGAAGGTAGCTATTTCTTTTTTATTTAAGAAAATGAATTTGCAATGATGATAAAA
TCTAAATGACAGAAAAATACATACTTATAATGGTAATATATGGTAAAACCATATATTGCT
AGTATGTACTTTCATTGTATGATGGCTTACACTTGATTTTGAGCAAATTCATTTTTTTAA
AATTATTTTTAATTAATTAAATTACTTTTTAAATCAAGAAAATTAAAAATTATTTTTTTA
GAACAATACAAATGCTATGATCCAACTATGACTTCTGACAGATGGGAGATTTTAGTTACT
TTTTCAGATGGTTAATTTAAGTAAGTATCGTTTGTAAATGGTATTTGCACATCTAGAGGT
GGTAAGCATGTAGATTTTGTCATTGATAAAATTGTTGAGAGAATGCAAGAATAAATCTTG
AAAAAGAATAAAGATCTTGATATCAAGCCTCATTAAATCAAACAAAATTTATTCATATTT
ATGAATTGCCTTATTGTTAACCCTTCGTTTGATTCTCAAACCAAAGACACTCTTACAACA
AAAGCCTCAGCTTTTGGATCAAAACCTGAATTATCAGAAAAATTTATCAAAAAAATATTG
GGTACTGGTATCATTGAGTAAATTGTTTCCTAAGCTAAAGCTCGTCAGAATGCTAAATTA
GCAAAAACTTTAAAGGGTGGGAAAAAAGGAAGAATTACAGGTATCCCAAAACTTGATGAT
GCTAATGATGCAGGTATTATTTTATAATTTATGAATAATATCATAAAAATACTGATTTAA
AATATAGGAACAGCAAGAAGTGAAAACTGTACATTAATCTTAACCGAAGGAGATTCAGCT
AAAGCATTAGCAATGGCTGGTATAGAAGTTGTAGGTAGGGATAATTATGGTGTATTCCCA
TTAAAGGGTAAGCTACTTAATGTTAGAGAAGCAAATAAGAAATAGATCATCGAAAACCAA
GAAATATAAAATATATGCAAAATCATAGGGCTAGATCCTGCTGTTTAAAACTATGAAAAT
GTATTTATTTTTTATTATTAAATATTATGCATTTAACTTAACATATATTTTAACAGACAA
AGCAATTAAGGTACGGATCTTTAATGATCATGGCTGATTAGGATAGTGATGGTTCCCATA
TTAAAGGTTTGGTCATAAACTTTATTCATCACTTCTGGCCTTCTCTGTTTAAAATGAAAG
GGTTTTTAAAAGAATTTATTACTCCCATCCTTAAAGTTACAAAAGGAGATGAAGTTCATT
CATTCTTTACAATATAAGATTTCAAAAATTTTGCTGCTTAAAAAGGAGACCGCCTTAAGT
AATACAAAGTTAAGTACTACAAAGGTCTTGGTACTTCGACTGACAAAGAAGCTAAAGAAT
ATTTCTCCAATTTCTATAAGCATCAAATTAATTTTTAATATTTAGATGAAAACGATATGG
AAGCTATTGAATTAGGTTTTTCAGGTAAAAAAATAAAAGAACGTAAGGACTGGCTAGCTA
ATTATGATCCTAATTCATTTGTTGATTATAATATAAAATAATTAAGATACAAGGATTTTA
TTGATAGAGAGCTTATTCACTTCTCAAATGCTGATAATTTAAGATCTATCCCATCGTTAT
GTGATGGCCTAAAGCCTGGTCAAAGAAAAATTCTATTTTCTTGTTTTAAAAGAAATTTAA
AATCAGAAATCAAAGTAACCAGAATAAAAAAATAAATTACTTATTAATTTTTCACTTTAA
TTAAAAAGGTAGCTTAATTAATTGGTTATGTTGCTGAGCACTCTGCATATCACCACGGTG
AATAATCACTCGCTTCAACTATCATCGGAATGGCATAAAATTTTGTAGGTTCTAATAATA
TAAATCTTATGATGCCTATTGGTTAGTTTGGTACACGTAATCAAGGTGGAAAAGAGCATG
CCTCTGCAAGATACATTTTTACAAGTCTGAGCAAAATTACTAGAATACTTTTTCCAGAGC
ATGATGATCATGTACTGAAGTATTTAGAAGACGATAATCAAGTAGTAGAACCAGAATGGT
ATTCATTGAATTTTAACTAACTTTAGAATTAATTTATTTTTAAAAATATAAAGGTACATG
CCAATTATTCCTATGTGTTTAGTAAATGGTAGTAGTGGTATTGGTACTGGTTGGTCAACT
GATATTCCTAACTATAATCACAAGGAAATTGTTGAATAAATTAGAGGGAAGCTGGAAGGA
AAGCCATTTACTGAATTACATCCTTGGTACAAAGGATTTTAAGGTTAAATAGAAATTAAT
CCTAAAGGTGGGTATATAGTCAAAGGGTAATACGAAATCGATGAAGTTGAAGAAACAATA
AAAATTACTGAATTACCTGTTGGTAAATGGACAAGAGACTATAAGGTAGTTTTAATTTGT
TAATTTATTAATGGAGTAAATATAATTAAATTTTTATAAAAGAATTATTTAGAAGAGCTA
CTATCACCACCAAAAGGAGAACCTGAAATTGAAGACATTCGTGAATATCATACAAATAAT
AGAGTTCATTTTGAAGTACAAGCAATACCAGGGAGAATATAATAATGGGGTGACATTGAG
AAAAAGCTTAAATTAAGCACAACAATGCAAACAACTAATATAGTTATGTTTAATGATAAA
TATAAATTAAAAAGATATCAAAGTACTGTAGAAATAATGGAAGAATTTTATGCTTTACGT
CTCAAATGCTACTAAAAAAGAAAAGATTATTTAGTCAGCAAAATTCAAAGAGATGTTGAT
ATTTTATAAAATAAGATGAAATTTATTACATTAGTTGTCAATGGTACTTTGGAAATTAGA
AATGCCAGAAAGAAAGGAGTTCTGAATAAACTTAAGGAGTTAGGTCTGACTCCAATGTCA
AAAATAACCAGAATCAATTCGACAAAAATCTAGGTAAATAAAATTTAAATTTGAAAAAAT
ATTAAAATAAATTTTACAAAAAAACAAAGGCATTTGAAGAAAAAAAGAAAGAAAGTTAAG
CTGAAAAAAATGAAGATAATGAAGATGAAGAAGTTTAATAAGACGAAGAGGAAGAAGAAG
AATAAGTTTAAGAAGGAGAAATTCCTTTATCTGAATACAACTACCTTCTCTCTATGCCTA
TCTTTTCTTTGACAGAAGAAAAGGTAATATTCTTTTTTATTAAATTAAAAAAATCAAGTT
AAAAATTAATATAGGTATTATAACTCAAAAAATAAGTAGAAGAAAAGGAAAGTGAACTTT
TGATCTTATAAAAGAAAGAAATAAAAGATATGTGGACAGAAGATTTAGATAAATTCATAG
AAGTAATACAATTTTAGAATTAATTTTAGATAAAGATTTTTAATAAATAATTTATAGGTT
ATTGAATAAGTAGAAGAAAAAGAAGAAAAAGAGAGACTTACAGGTAAAGGGTTTACATAG
AATGGCAAAGCCCGTGCTAAAAAGAAAAATAACAATAAAGAAAAAGAATAAAAAAAATAA
TAAAATAACTCTTCAGATGACGAAAGCGAAAAGAAAACTGTTGTAAAAAATAAAAATCCA
TAAAAATCTGATAATGAAAAATAAAAGCCAAAAGAAAATAATGATAAATAAAAGAAAATA
GATGAAAGTTTTCTTGTGAAGAAAAAAATGGATGCAGAACAATAAAAAACAGAAGAAAAG
GTATAAAAGAAAGAATAGAAGAAAGAGCCAATGAAGTAGCTCTCACTGATTGAAAGAATA
TCTTAAAAATATAGTAATCAGGCGGAATAATAAGTAACGGCAGATATACTTGACACAAAT
AAACGTAAAAAAGATCCATCTTCAACTTCTACCTCTGTTTATTCAATGGATATGCCATAA
TAAAACCTAAAGGTAATTTAATTTAAATTTTTTATTTTTTTTGACATATTTCTTTTTTCT
AGCGAAAGAAAAATAATAAATTGAAAGAAGATGATGATGATTTTGACCTTGATTTAGATT
TCTTAGAACCTAGTTAGATAATTATGAATCCTAGCTAAGATCCTAATAAAAGAACCTTAA
GGTCAAATGGGAAGAAGCCAAGAACGATTTATAAACTAGATTCGGATTCTGATAATGATG
AATTCAATCAGTAAAATGATGAATCTGATGAAGAAGAGGAAGAGGAATTTGTTATGATGC
CTTCTAAGAGCAATAAGAAAAAATTATTTGATGAGGATGAGGATGATTGA