Identifiers and Description

Gene Model Identifier

TTHERM_01299650

Standard Name

TOP1 (Topoisomerase I)

Aliases

PreTt17571 | 315.m00022

Description

Eukaryotic DNA topoisomerase I, catalytic core family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01028 ) Eukaryotic DNA topoisomerase I, catalytic
  • ( PF02919 ) Eukaryotic DNA topoisomerase I, DNA

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01299650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_240700
Tetrahymena borealisEI9_19658.19.997093137033517e-262eukaryotic DNA topoisomerase I
, catalytic core family protei
n (691 aa)
OxytrichaContig11896.0.g1039.997093137033517e-262Eukaryotic DNA topoisomerase I
, catalytic core
DictyBaseDDB_G02832051.9990846765523993e-155top1 on chromosome: 4 position
416900 to 419809
SGDYOL006C1.999872053281847e-142TOP1 Topoisomerase I, nuclear
enzyme that relieves torsional
strain in DNA by cleaving and
re-sealing the phosphodiester
backbone; relaxes both positi
vely and negatively supercoile
d DNA; functions in replicatio
n, transcription, and recombin
ation
WormBaseWBGene000065951.0003279799459891e-139locus:top-1 DNA topoisomeras
e 1 status:Confirmed UniPr
ot:O17966 protein_id:CAB0763
9.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01299650(coding)
ATGAGTAGCAAGAAGAACACTAAGAAAGTCTCTGATAGCGAGGACGATGATTTTGAAGAG
GAAGAAGATGAATCAGAAGGTTCAGGAGAGGAGGATTCCGCTGAAAATAGTGTCAAAGAA
GAAGAAGATGAAGAAGAAGAAGAAAACGGTGATAATGAAATTAAAGAGGAAGATAACGCA
GATACAAAAATAGAAGTTAAGGATGAAAATGAAGATGATGAAGAAGAAGAAGAATTTAAA
CCTTCGATTAATGGCAATAAAAGAAAGAACGATACACCTGTTGAAAAGGCAGCAGGATTG
TCAAATGCTAAATAAGTGAAAACATCTGGCGGTGATGCAGTTAAGAAACCAGTGTAAAAG
TAACAAGACAGTGATGATGAAGACGATGAAAACAGTGATATTAAATGGAAATATTTAGAG
CATCACGGAGTGCTATTCCCCGATTATTGGTAAAAGCATAATGTAAGACCTAGGTATGAT
GGAAAACCTATTGATTTAAATCTCTTGTAAGAAGAAATGGCTACTTATTGGTCATAAACT
TTAGGAACAGATTGGGAACATAAACCTAAGTACAGAGAGAATTTTTCAAAACAATTCCTC
GATACCTTTGGTAAGGATAAAGGTAAATATGACTTTGATAAGTTCGACTTCACTCCTATA
AAAATACATCTTGAAGAGCAAAAAGAAATCCGTAAAAATCGCTCCAAAGAAGAAAAAAAT
CAAGAAAAGTAGAAAAAAGAAAGGCTTTCTGATTATTATGCTGGCGCAATTCTAGACGGA
TTTAGAGAAAAAGTAGGATAATTCATGATTGAACCTCCAACTCTCTTTAAAGGTAGAGGT
GAACATCCAAAAATGGGTATGATGAAAGGTCGTATTTAACCAGAAGCTGTTGTTATTAAT
ATCTCAAAAGATGCACCTGTCCCAAAATGTTCAGTTCCTGGTCATGGTTGGAGTGAAATA
GTCCACAAACAAGATGTTACTTGGTTAGCAAGCTACAAGGATGATTCTGTAAAGAAGCAA
CATAAATATATCTTCTTATCTGCTGAAAGTAAGCTTAAGGCAGAAAATGATAAAAAGAAA
TACGAAAAAGCAAGACGTCTTAAAAATTTAATTGGATAGATTCGTGAAAATTACGAGAGA
AAATTAAGAAGTAGTGATCCTGTTGATAGATAATTAGGTACTGCTACTTACTTGATTGAT
AAGTTAGCACTCAGAGTTGGTAATGAAAAATCAGAAGAAGAAGCAGATACTGTCGGTTGC
TGCTCTTTGAGAGTTGAGCATATTTAAGTTATAGAAGATACCTAGATTGGATTCGATTTC
TTAGGTAAGGATTCTATGAGATATCAAAATACTGTAAAAGTTACTGAGATTGTTTGGAAA
AATATGTAGTCTTTTATCAAGAATAAAAAACCTGGTGATGATTTATTCGATAGAATTGAT
GCAAGTAGCCTAAATGAATATTTAAAGAGTTAGATGGAAGGTTTGACAGCAAAAGTTTTT
AGAACTTATAATGCTTCTCACACTCTTTAAAAAGAATTAGACAAGGCTGATGAAGAAGGC
CTTGATAAGATGGATTTAAAAGATAAACTTAATTTTTATGATGAAGCTAACAGAAATGTT
GCCATTCTTTGTAACCATCAAAAAACAGTAGGCAAAAACTTTGATGTAATGGTTGGAAAA
ATGGAACAAAGAATTAATGTTTATAAAGATTATGAAAAGGAATTACATACTCATTTAAAC
AAATGCAAAAAGAATGGAGTCAATGCTTATGAAAAAGAAGTTATCTTAGAAGAAAAGGAT
GATGGAAAACATAAAATGTTTGTTAAAAAGTTCCCTGGAACAAAGGAAAAAATTTAAGAA
GCTATTGAAAAAATTAAAAAGAAGATAGACGAAGAATAAAATAAAAAATAATCTAAAGAG
AAGAACAAAGAAATTGCCTTAGGTACTTCTAAAACAAATTACAACGATCCTAGAATATCT
GTTGTTTGGTGTAAAAAGTGGGAAGTTCCTGTAGAAAAAGTTTTCCCTAAAACTCTCATT
GCTAAGTTCGTTTGGGCTATGGATACAGATTTAGAGTGGTCATTCTGA


>TTHERM_01299650(protein)
MSSKKNTKKVSDSEDDDFEEEEDESEGSGEEDSAENSVKEEEDEEEEENGDNEIKEEDNA
DTKIEVKDENEDDEEEEEFKPSINGNKRKNDTPVEKAAGLSNAKQVKTSGGDAVKKPVQK
QQDSDDEDDENSDIKWKYLEHHGVLFPDYWQKHNVRPRYDGKPIDLNLLQEEMATYWSQT
LGTDWEHKPKYRENFSKQFLDTFGKDKGKYDFDKFDFTPIKIHLEEQKEIRKNRSKEEKN
QEKQKKERLSDYYAGAILDGFREKVGQFMIEPPTLFKGRGEHPKMGMMKGRIQPEAVVIN
ISKDAPVPKCSVPGHGWSEIVHKQDVTWLASYKDDSVKKQHKYIFLSAESKLKAENDKKK
YEKARRLKNLIGQIRENYERKLRSSDPVDRQLGTATYLIDKLALRVGNEKSEEEADTVGC
CSLRVEHIQVIEDTQIGFDFLGKDSMRYQNTVKVTEIVWKNMQSFIKNKKPGDDLFDRID
ASSLNEYLKSQMEGLTAKVFRTYNASHTLQKELDKADEEGLDKMDLKDKLNFYDEANRNV
AILCNHQKTVGKNFDVMVGKMEQRINVYKDYEKELHTHLNKCKKNGVNAYEKEVILEEKD
DGKHKMFVKKFPGTKEKIQEAIEKIKKKIDEEQNKKQSKEKNKEIALGTSKTNYNDPRIS
VVWCKKWEVPVEKVFPKTLIAKFVWAMDTDLEWSF


>TTHERM_01299650(gene)
ATGAGTAGCAAGAAGAACACTAAGAAAGTCTCTGATAGCGAGGACGATGATTTTGAAGAG
GAAGAAGATGAATCAGAAGGTTCAGGAGAGGAGGATTCCGCTGAAAATAGTGTCAAAGAA
GAAGAAGATGAAGAAGAAGAAGAAAACGGTGATAATGAAATTAAAGAGGAAGATAACGCA
GATACAAAAATAGAAGTTAAGGATGAAAATGAAGATGATGAAGAAGAAGAAGAATTTAAA
CCTTCGATTAATGGCAATAAAAGAAAGAACGATACACCTGTTGAAAAGGCAGCAGGATTG
TCAAATGCTAAATAAGTGAAAACATCTGGCGGTGATGCAGTTAAGAAACCAGTGTAAAAG
TAACAAGACAGTGATGATGAAGACGATGAAAACAGTGATATTAAATGGAAATATTTAGAG
CATCACGGAGTGCTATTCCCCGATTATTGGTAAAAGCATAATGTAAGACCTAGGTATGAT
GGAAAACCTATTGATTTAAATCTCTTGTAAGAAGAAATGGCTACTTATTGGTCATAAACT
TTAGGAACAGATTGGGAACATAAACCTAAGTACAGAGAGAATTTTTCAAAACAATTCCTC
GATACCTTTGGTAAGGATAAAGGTAAATATGACTTTGATAAGTTCGACTTCACTCCTATA
AAAATACATCTTGAAGAGCAAAAAGAAATCCGTAAAAATCGCTCCAAAGAAGAAAAAAAT
CAAGAAAAGTAGAAAAAAGAAAGGCTTTCTGATTATTATGCTGGCGCAATTCTAGACGGA
TTTAGAGAAAAAGTAGGATAATTCATGATTGAACCTCCAACTCTCTTTAAAGGTAGAGGT
GAACATCCAAAAATGGGTATGATGAAAGGTCGTATTTAACCAGAAGCTGTTGTTATTAAT
ATCTCAAAAGATGCACCTGTCCCAAAATGTTCAGTTCCTGGTAAAATAAATTAATTTATT
TATTATAATTATCTATGATAAATAAAAAATTTTAAGTATCCTACTAAAAGTTATAAACAA
ACAACAAGCATTCATTCATTCATTCATTCATTTTCTGGCCAATTAAATTTTAATATCTTT
AAACTTAATATTCTCTCTTTTCATAATATAATTATGTTTATAATGCCAATATTAAATCAA
TTTGTTTCATATTTAATGTATTTTCAAAAGCTATACATCCTTAATTAATCATATTTAGCT
TTTTACACAAGACTGTATTCATATATGTAGATAGATATTTAACGAATTTCCTAAAAAATA
ATTAGGTCATGGTTGGAGTGAAATAGTCCACAAACAAGATGTTACTTGGTTAGCAAGCTA
CAAGGATGATTCTGTAAAGAAGCAACATAAATATATCTTCTTATCTGCTGAAAGTAAGCT
TAAGGCAGAAAATGATAAAAAGAAATACGAAAAAGCAAGACGTCTTAAAAATTTAATTGG
ATAGATTCGTGAAAATTACGAGAGAAAATTAAGAAGTAGTGATCCTGTTGATAGATAATT
AGGTACTGCTACTTACTTGATTGATAAGTTAGCACTCAGAGTTGGTAATGAAAAATCAGA
AGAAGAAGCAGATACTGTCGGTTGCTGCTCTTTGAGAGTTGAGCATATTTAAGTTATAGA
AGATACCTAGATTGGATTCGATTTCTTAGGTATTTAAATTTTTTTCTATTATTAAAATAA
TCAATTTATTTTTATTTATTTATGTAGACAAAATTTTATATAAAATTAATTTTTAAAAAA
AGGTAAGGATTCTATGAGATATCAAAATACTGTAAAAGTTACTGAGATTGTTTGGAAAAA
TATGTAGTCTTTTATCAAGAATAAAAAACCTGGTGATGATTTATTCGATAGAATTGATGC
AAGTAGCCTAAATGAATATTTAAAGAGTTAGATGGAAGGTTTGACAGCAAAAGTTTTTAG
AACTTATAATGCTTCTCACACTCTTTAAAAAGAATTAGACAAGGCTGATGAAGAAGGCCT
TGATAAGATGGATTTAAAAGATAAACTTAATTTTTATGATGAAGCTAACAGAAATGTTGC
CATTCTTTGTAACCATCAAAAAACAGTAGGCAAAAACTTTGATGTAATGGTTGGAAAAAT
GGAACAAAGAATTAATGTTTATAAAGATTATGAAAAGGAATTACATACTCATTTAAACAA
ATGCAAAAAGAATGGAGTCAATGCTTATGAAAAAGAAGTTATCTTAGAAGAAAAGGATGA
TGGAAAACATAAAATGTTTGTTAAAAAGTTCCCTGGAACAAAGGAAAAAATTTAAGAAGC
TATTGAAAAAATTAAAAAGAAGATAGACGAAGAATAAAATAAAAAATAATCTAAAGAGAA
GAACAAAGAAATTGCCTTAGGTACTTCTAAAACAAATTACAACGATCCTAGAATATCTGT
TGTTTGGTGTAAAAAGTGGGAAGTTCCTGTAGAAAAAGTTTTCCCTAAAACTCTCATTGC
TAAGTTCGTTTGGGCTATGGATACAGATTTAGAGTGGTCATTCTGA